VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Measles virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
    6. Host Protective Immunity
  2. Vaccine Related Pathogen Genes
    1. F fusion protein (Protective antigen)
    2. H hemagglutinin protein (Protective antigen)
    3. M matrix protein (Protective antigen)
    4. N nucleocapsid protein (Protective antigen)
    5. P phosphoprotein (Protective antigen)
  3. Vaccine Related Host Genes
    1. IFNG
  4. Vaccine Information
    1. ALVAC-MV-HA/F
    2. Attenuvax
    3. Canine Distemper-Adenovirus Type 2-Measles-Parainfluenza Modified Live Virus Vaccine (USDA: 1341.20)
    4. Canine Distemper-Measles Modified Live Virus Vaccine (USDA: 1351.20)
    5. Eolarix
    6. M-M-R II
    7. Measles Virus vaccine VEE/SIN-H
    8. Measles Virus vaccine VEE/SIN-H+F
    9. Measles Virus Vaccine VVM
    10. Measles Virus Vaccine VVN
    11. Measles Virus Vaccine VVP
    12. Priorix
    13. Priorix-Tetra
    14. ProQuad
  5. References
I. General Information
1. NCBI Taxonomy ID:
11234
2. Disease:
Measles
3. Introduction
Measles virus is a negative strand RNA virus in the Morbillivirus genus of the Paramyxoviridae family. The virus was first isolated in 1954. Measles virus causes measles, a highly infectious disease of humans spread by the respiratory route and characterized by fever and rash. Important complications include secondary infections associated with MV-induced immune suppression and the neurological disease post-infectious encephalomyelitis (Griffin et al., 2008).
4. Microbial Pathogenesis
Measles virus (MV) has two envelope glycoproteins, the haemagglutinin (H) and fusion proteins, which are responsible for attachment and membrane fusion, respectively. Human signalling lymphocyte activation molecule (SLAM; also called CD150), a membrane glycoprotein of the immunoglobulin superfamily, acts as a cellular receptor for MV. SLAM is expressed on immature thymocytes, activated lymphocytes, macrophages and dendritic cells. It regulates production of interleukin (IL)-4 and IL-13 by CD4+ T cells, as well as production of IL-12, tumour necrosis factor alpha and nitric oxide by macrophages. The distribution of SLAM is in accord with the lymphotropism and immunosuppressive nature of MV (Yanagi et al., 2006).
5. Host Ranges and Animal Models
Humans are the only known natural host of measles, although the virus can infect some non-human primate species (Wiki: Measles).
6. Host Protective Immunity
Although innate responses probably contribute to control of virus replication during the incubation period, the onset of clinically apparent disease coincides with the appearance of MV-specific adaptive humoral and cellular immune responses. Antibody can protect from MV infection and may contribute to recovery from infection. Antibody is sufficient for protection because infants are protected by maternal antibody and passive transfer of immune serum can modify or interfere with measles vaccination and can partially protect children from measles after exposure. The best correlate of protection from infection is the level of neutralizing antibody. In infants, the level of maternal antibody correlates with failure of the humoral response to vaccination (Griffin et al., 2008).
1. F fusion protein
  • Gene Name : F fusion protein
  • Sequence Strain (Species/Organism) : Measles morbillivirus
  • VO ID : VO_0011167
  • NCBI Gene ID : 1489800
  • NCBI Protein GI : 9626950
  • Locus Tag : MeVgp4
  • Genbank Accession : AB016162
  • Protein Accession : NP_056922
  • Taxonomy ID : 11234
  • Gene Starting Position : 4875
  • Gene Ending Position : 7246
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 8.55
  • Protein Weight : 55859.92
  • Protein Length : 550
  • Protein Note : additional G inserted at 2499:V
  • DNA Sequence : Show Sequence
    >NC_001498.1:4875-7246 Measles virus, complete genome
    AGGGCCAAGGAACACACACACTCGACAGAACCCAGACCCCGGCCCGCGGCACCGCGCCCCCACCCCCCGA
    AAACCAGAGGGAGCCCCCAACCAAACCCGCCGGCCCCCCCGGTGCCCACAGGTAGGCACACCAACCCCCG
    ACCAGACCCAGCACCCAGCCACCGACAATCCAAGACGGGGGGCCCCCCCCAAAAAAAGGCCCCCAGGGGC
    CGACAGCCAGCATCGCGAGGAAGCACACCCACCCCACACACGACCACGGCAACCGAACCAGAGTCCAGAC
    CACCCTGGGCCACCAGCTCCCAGACTCGGCCATCACCCCGCAAAAAGGAAAGGCCACAACCCGCGCACCC
    CAGCCCCGATCCGGCGGGCAGCCACTCAACCCGAACCAGCACCCAAGAGCGATCCCTGGGGGACCCCCAA
    ACCGCAAAAGACATCAGTATCCCACAGCCTCTCCAAGTCCCCCGGTCTCCTCCTCTTCTCGAAGGGACCA
    AAAGATCAATCCACCACATCCGACGACACTCAATTCCCCACCCCCAAAGGAGACACCGGGAATCCCAGAA
    TCAAGACTCATCCAGTGTCCATCATGGGTCTCAAGGTGAACGTCTCTGCCATATTCATGGCAGTACTGTT
    AACTCTCCAAACACCCACCGGTCAAATCCATTGGGGCAATCTCTCTAAGATAGGGGTGGTAGGGATAGGA
    AGTGCAAGCTACAAAGTTATGACTCGTTCCAGCCATCAATCATTGGTCATAAAATTAATGCCCAATATAA
    CTCTCCTCAATAACTGCACGAGGGTAGAGATCGCAGAATACAGGAGACTACTGAGAACAGTTTTGGAACC
    AATTAGAGATGCACTTAATGCAATGACCCAGAATATAAGACCGGTTCAGAGTGTAGCTTCAAGTAGGAGA
    CACAAGAGATTTGCGGGAGTTGTCCTGGCAGGTGCGGCCCTAGGCGTTGCCACAGCTGCTCAGATAACAG
    CCGGCATTGCACTTCACCAGTCCATGCTGAACTCTCAAGCCATCGACAATCTGAGAGCAAGCCTGGAAAC
    TACTAATCAGGCAATTGAGGCAATCAGACAAGCAGGGCAGGAGATGATATTGGCTGTTCAGGGTGTCCAA
    GACTACATCAATAATGAGCTGATACCGTCTATGAACCAACTATCTTGTGATTTAATCGGCCAGAAGCTAG
    GGCTCAAATTGCTCAGATACTATACAGAAATCCTGTCATTATTTGGCCCCAGCTTACGGGACCCCATATC
    TGCGGAGATATCCATCCAGGCTTTGAGCTATGCGCTTGGAGGAGATATCAATAAGGTATTAGAAAAGCTC
    GGATACAGTGGAGGTGATTTACTGGGCATCTTAGAGAGCAGAGGAATAAAGGCCCGGATAACTCACGTCG
    ACACAGAGTCCTACTTCATTGTACTCAGTATAGCCTATCCGACGCTGTCCGAGATTAAGGGGGTGATTGT
    CCACCGGCTAGAGGGGGTCTCGTACAATATAGGCTCTCAAGAGTGGTATACCACTGTGCCCAAGTATGTT
    GCAACCCAAGGGTACCTTATCTCGAATTTTGATGAGTCATCGTGTACTTTCATGCCAGAGGGGACTGTGT
    GCAGCCAAAATGCCTTGTACCCGATGAGTCCTCTGCTCCAAGAATGCCTCCGGGGGTCCACCAAGTCCTG
    TGCTCGTACACTCGTATCCGGGTCTTTTGGGAACCGGTTCATTTTATCACAAGGGAACCTAATAGCCAAT
    TGTGCATCAATCCTCTGCAAGTGTTACACAACAGGAACGATCATTAATCAAGACCCTGACAAGATCCTAA
    CATACATTGCTGCCGATCACTGCCCGGTGGTCGAGGTGAACGGTGTGACCATCCAAGTCGGGAGCAGGAG
    GTATCCGGACGCGGTGTACCTGCACAGAATTGACCTCGGTCCTCCCATATCATTGGAGAGGTTGGACGTA
    GGGACAAATCTGGGGAATGCAATTGCTAAGTTGGAGGATGCCAAGGAATTGTTGGAGTCATCGGACCAGA
    TATTGAGGAGTATGAAAGGTTTATCGAGCACTAGCATAGTTTACATCCTGATTGCAGTGTGTCTTGGAGG
    GTTGATAGGGATCCCCGCTTTAATATGTTGCTGCAGGGGGCGCTGTAACAAAAAGGGAGAACAAGTTGGT
    ATGTCAAGACCAGGCCTAAAGCCTGATCTTACAGGGACATCAAAATCCTATGTAAGGTCGCTCTGATCCT
    CTACAACTCTTGAAACACAGATTTCCCACAAGTCTCCTCTTCGTCATCAAGCAACCACCGCATCCAGCAT
    CAAGCCCACCTGAAATTGTCTCCGGCTTCCCTCTGGCCGAACGATATCGGTAGTTAATTAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_056922.1 fusion protein [Measles morbillivirus]
    MGLKVNVSAIFMAVLLTLQTPTGQIHWGNLSKIGVVGIGSASYKVMTRSSHQSLVIKLMPNITLLNNCTR
    VEIAEYRRLLRTVLEPIRDALNAMTQNIRPVQSVASSRRHKRFAGVVLAGAALGVATAAQITAGIALHQS
    MLNSQAIDNLRASLETTNQAIEAIRQAGQEMILAVQGVQDYINNELIPSMNQLSCDLIGQKLGLKLLRYY
    TEILSLFGPSLRDPISAEISIQALSYALGGDINKVLEKLGYSGGDLLGILESRGIKARITHVDTESYFIV
    LSIAYPTLSEIKGVIVHRLEGVSYNIGSQEWYTTVPKYVATQGYLISNFDESSCTFMPEGTVCSQNALYP
    MSPLLQECLRGSTKSCARTLVSGSFGNRFILSQGNLIANCASILCKCYTTGTIINQDPDKILTYIAADHC
    PVVEVNGVTIQVGSRRYPDAVYLHRIDLGPPISLERLDVGTNLGNAIAKLEDAKELLESSDQILRSMKGL
    SSTSIVYILIAVCLGGLIGIPALICCCRGRCNKKGEQVGMSRPGLKPDLTGTSKSYVRSL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice vaccinated with a vaccinia virus recombinant encoding the fusion protein of Measles virus developed measles neutralizing antibodies. The mice also resisted a normally lethal intracerebral inoculation of a cell-associated measles virus subacute sclerosing panencephalitis strain (Drillien et al., 1988).
  • Related Vaccine(s): ALVAC-MV-HA/F , Measles Virus vaccine VEE/SIN-H+F
2. H hemagglutinin protein
  • Gene Name : H hemagglutinin protein
  • Sequence Strain (Species/Organism) : Measles morbillivirus
  • VO ID : VO_0011166
  • NCBI Gene ID : 1489801
  • NCBI Protein GI : 9626951
  • Locus Tag : MeVgp5
  • Genbank Accession : AB016162
  • Protein Accession : NP_056923
  • 3D structure: PDB ID : 2RKC
  • Taxonomy ID : 11234
  • Gene Starting Position : 7250
  • Gene Ending Position : 9207
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 7.85
  • Protein Weight : 64311.39
  • Protein Length : 617
  • DNA Sequence : Show Sequence
    >NC_001498.1:7250-9207 Measles virus, complete genome
    TAGGGTGCAAGATCATCCACAATGTCACCACAACGAGACCGAATAAATGCCTTCTACAAAGACAACCCAC
    ATCCTAAGGGAAGTAGGATAGTTATTAACAGAGAACATCTTATGATTGATAGACCTTATGTTTTGCTGGC
    TGTTCTATTCGTCATGTTTCTGAGCTTGATCGGGTTGCTAGCCATTGCAGGCATTAGACTCCATCGTGCA
    GCCATCTACACCGCAGAGATCCATAAGAGCCTCAGCACCAATCTAGATGTAACTAACTCGATCGAGCATC
    AGGTCAAGGACGTGCTGACACCACTCTTCAAGATCATTGGTGATGAAGTGGGCCTGAGGACACCTCAGAG
    ATTCACTGACCTAGTGAAATTCATCTCTGACAAAATTAAATTCCTTAATCCGGATAGGGAGTACGACTTC
    AGAGATCTCACTTGGTGTATCAACCCGCCAGAGAGAATCAAATTGGATTATGATCAATACTGTGCAGATG
    TGGCTGCTGAAGAACTCATGAATGCATTGGTGAACTCAACTCTACTGGAGGCCAGGGCAACCAATCAGTT
    CCTAGCTGTCTCAAAGGGAAACTGCTCAGGGCCCACTACAATCAGAGGTCAATTCTCAAACATGTCGCTG
    TCCCTGTTGGACTTGTATTTAAGTCGAGGTTACAATGTGTCATCTATAGTCACTATGACATCCCAGGGAA
    TGTACGGGGGAACTTACCTAGTGGGAAAGCCTAATCTGAGCAGTAAAGGGTCAGAGTTGTCACAACTGAG
    CATGCACCGAGTGTTTGAAGTAGGGGTTATCAGAAATCCGGGTTTGGGGGCTCCGGTGTTCCATATGACA
    AACTATTTTGAGCAACCAGTCAGTAATGATTTCAGCAACTGCATGGTGGCTTTGGGGGAGCTTAAATTCG
    CAGCCCTCTGTCACAGGGAAGATTCTATCACAATTCCCTATCAGGGGTCAGGGAAAGGTGTCAGCTTCCA
    GCTCGTCAAGCTAGGTGTCTGGAAATCCCCAACCGACATGCGATCCTGGGTCCCCCTATCAACGGATGAT
    CCAGTGATAGATAGGCTTTACCTCTCATCTCACAGAGGTGTTATCGCTGACAATCAAGCAAAATGGGCTG
    TCCCGACAACACGGACAGATGACAAGTTGCGAATGGAGACATGCTTCCAGCAGGCGTGTAAGGGTAAAAA
    CCAAGCACTCTGCGAGAATCCCGAGTGGGCACCATTGAAGGATAACAGGATTCCTTCATACGGGGTCTTG
    TCTGTTAATCTGAGTCTGACAGTTGAGCTTAAAATCAAAATTGCTTCAGGATTCGGGCCATTGATCACAC
    ACGGTTCAGGGATGGACCTATACAAAACCAACCACAACAATGTGTATTGGCTGACTATCCCGCCAATGAA
    GAACCTAGCCTTAGGTGTAATCAACACATTGGAGTGGATACCGAGATTCAAGGTTAGTCCCAACCTCTTC
    ACTGTTCCAATCAAGGAAGCAGGCGAGGACTGCCATGCCCCAACATACCTACCTGCGGAGGTGGATGGTG
    ATGTCAAACTCAGTTCCAATCTGGTAATTCTACCTGGTCAGGATCTCCAATATGTTTTGGCAACCTACGA
    TACTTCCAGGGTTGAACATGCTGTGGTTTATTATGTTTACAGCCCAAGCCGCTCATTTTCTTACTTTTAT
    CCTTTTAGGTTGCCTATAAAGGGGGTCCCAATCGAATTACAAGTGGAATGCTTCACATGGGACAAAAAAC
    TCTGGTGCCGTCACTTCTGTGTGCTTGCGGACTCAGAATCTGGTGGACATATCACTCACTCTGGGATGGT
    GGGCATGGGAGTCAGCTGCACAGTCACTCGGGAAGATGGAACCAATCGCAGATAGGGCTGCCAGTGAACC
    GATCACATGATGTCACCCAGACATCAGGCATACCCACTAGTGTGAAATAGACATCAGAATTAAGAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_056923.1 hemagglutinin protein [Measles morbillivirus]
    MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRLHRAAIYTAEI
    HKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISDKIKFLNPDREYDFRDLTWCI
    NPPERIKLDYDQYCADVAAEELMNALVNSTLLEARATNQFLAVSKGNCSGPTTIRGQFSNMSLSLLDLYL
    SRGYNVSSIVTMTSQGMYGGTYLVGKPNLSSKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYFEQPV
    SNDFSNCMVALGELKFAALCHREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMRSWVPLSTDDPVIDRLY
    LSSHRGVIADNQAKWAVPTTRTDDKLRMETCFQQACKGKNQALCENPEWAPLKDNRIPSYGVLSVNLSLT
    VELKIKIASGFGPLITHGSGMDLYKTNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSPNLFTVPIKEA
    GEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVYYVYSPSRSFSYFYPFRLPIK
    GVPIELQVECFTWDKKLWCRHFCVLADSESGGHITHSGMVGMGVSCTVTREDGTNRR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Chimeric Venezuelan equine encephalitis/Sindbis virus (VEE/SIN) replicon particles were used to express the hemagglutinin (H) and fusion (F) proteins of measles virus (MV). When challenged with wild-type MV 12 to 17 months after vaccination, all vaccinated juvenile and infant monkeys vaccinated with VEE/SIN-H, VEE/SIN-H+F, and LAV were protected from rash and viremia (Pan et al., 2010).
  • Related Vaccine(s): ALVAC-MV-HA/F , Measles Virus vaccine VEE/SIN-H , Measles Virus vaccine VEE/SIN-H+F
3. M matrix protein
  • Gene Name : M matrix protein
  • Sequence Strain (Species/Organism) : Measles morbillivirus
  • VO ID : VO_0011170
  • NCBI Gene ID : 1489803
  • NCBI Protein GI : 9626949
  • Locus Tag : MeVgp3
  • Genbank Accession : AB002686
  • Protein Accession : NP_056921
  • Taxonomy ID : 11234
  • Gene Starting Position : 3405
  • Gene Ending Position : 4871
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 9.25
  • Protein Weight : 35032.9
  • Protein Length : 335
  • DNA Sequence : Show Sequence
    >NC_001498.1:3405-4871 Measles virus, complete genome
    TAGGAGCAAAGTGATTGCCTCCTAAGTTCCACAATGACAGAGATCTACGATTTCGACAAGTCGGCATGGG
    ACATCAAAGGGTCGATCGCTCCGATACAACCTACCACCTACAGTGATGGCAGGCTGGTGCCCCAGGTCAG
    AGTCATAGATCCTGGTCTAGGTGATAGGAAGGATGAATGCTTTATGTACATGTTTCTGCTGGGGGTTGTT
    GAGGACAGCGATCCCCTAGGGCCTCCAATCGGGCGAGCATTCGGGTCCCTGCCCTTAGGTGTTGGTAGAT
    CCACAGCAAAACCCGAGGAACTCCTCAAAGAGGCCACTGAGCTTGACATAGTTGTTAGACGTACAGCAGG
    GCTCAATGAAAAACTGGTGTTCTACAACAACACCCCACTAACCCTCCTCACACCTTGGAGAAAGGTCCTA
    ACAACAGGGAGTGTCTTCAATGCAAACCAAGTGTGCAATGCGGTTAATCTAATACCGCTGGACACCCCGC
    AGAGGTTCCGTGTTGTTTATATGAGCATCACCCGTCTTTCGGATAACGGGTATTACACCGTTCCCAGAAG
    AATGCTGGAATTCAGATCGGTCAATGCAGTGGCCTTCAACCTGCTAGTGACCCTTAGGATTGACAAGGCG
    ATTGGCCCTGGGAAGATCATCGACAATGCAGAGCAACTTCCTGAGGCAACATTTATGGTCCACATCGGGA
    ACTTCAGGAGAAAGAAGAGTGAAGTCTACTCTGCCGATTATTGCAAAATGAAAATCGAAAAGATGGGCCT
    GGTTTTTGCACTTGGTGGGATAGGGGGCACCAGTCTTCACATTAGAAGCACAGGCAAAATGAGCAAGACT
    CTCCATGCACAACTCGGGTTCAAGAAGACCTTATGTTACCCACTGATGGATATCAATGAAGACCTTAATC
    GGTTACTCTGGAGGAGCAGATGCAAGATAGTAAGAATCCAGGCAGTTTTGCAGCCATCAGTTCCTCAAGA
    ATTCCGCATTTACGACGACGTGATCATAAATGATGACCAAGGACTATTCAAAGTTCTGTAGACCGCAGTG
    CCCAGCAATACCCGAAAACGACCCCCCTCATAATGACAGCCAGAAGGCCCGGACAAAAAAGCCCCCTCCA
    GAAGACTCCACGGACCAAGCGAGAGGCCAGCCAGCAGCCGACAGCAAGTGTGGACACCAGGCGGCCCAAG
    CACAGAACAGCCCCGACACAAGGCCACCACCAGCCATCCCAATCTGCGTCCTCCTCGTGGGACCCCCGAG
    GACCAACCCCGAAGGTCGCTCCGAACACAGACCACCAACCGCATCCCCACAGCTCCCGGGAAAGGAACCC
    CCAGCAACTGGAAGGCCCCTCCCCCCCTCCCCCAACGCAAGAACCCCACAACCGAACCGCACAAGCGACC
    GAGGTGACCCAACCGCAGGCATCCGACTCCTTAGACAGATCCTCTCCCCCCGGCATACTAAACAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_056921.1 matrix protein [Measles morbillivirus]
    MTEIYDFDKSAWDIKGSIAPIQPTTYSDGRLVPQVRVIDPGLGDRKDECFMYMFLLGVVEDSDPLGPPIG
    RAFGSLPLGVGRSTAKPEELLKEATELDIVVRRTAGLNEKLVFYNNTPLTLLTPWRKVLTTGSVFNANQV
    CNAVNLIPLDTPQRFRVVYMSITRLSDNGYYTVPRRMLEFRSVNAVAFNLLVTLRIDKAIGPGKIIDNAE
    QLPEATFMVHIGNFRRKKSEVYSADYCKMKIEKMGLVFALGGIGGTSLHIRSTGKMSKTLHAQLGFKKTL
    CYPLMDINEDLNRLLWRSRCKIVRIQAVLQPSVPQEFRIYDDVIINDDQGLFKVL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Lewis rats were immunized with recombinant vaccinia virus (VV) expressing various proteins of measles virus (MV). VVM (Matrix Protein) -immunized rats were partially protected from MV challenge (Brinckmann et al., 1991).
  • Related Vaccine(s): Measles Virus Vaccine VVM
4. N nucleocapsid protein
  • Gene Name : N nucleocapsid protein
  • Sequence Strain (Species/Organism) : Measles morbillivirus
  • VO ID : VO_0011168
  • NCBI Gene ID : 1489804
  • NCBI Protein GI : 9626946
  • Locus Tag : MeVgp1
  • Genbank Accession : AB016162
  • Protein Accession : NP_056918
  • Taxonomy ID : 11234
  • Gene Starting Position : 55
  • Gene Ending Position : 1743
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 4.86
  • Protein Weight : 55436.53
  • Protein Length : 525
  • DNA Sequence : Show Sequence
    >NC_001498.1:55-1743 Measles virus, complete genome
    TAGGATTCAAGATCCTATTATCAGGGACAAGAGCAGGATTAGGGATATCCGAGATGGCCACACTTTTGAG
    GAGCTTAGCATTGTTCAAAAGAAACAAGGACAAACCACCCATTACATCAGGATCCGGTGGAGCCATCAGA
    GGAATCAAACACATTATTATAGTACCAATTCCTGGAGATTCCTCAATTACCACTCGATCCAGACTACTGG
    ACCGGTTGGTCAGGTTAATTGGAAACCCGGATGTGAGCGGGCCCAAACTAACAGGGGCACTAATAGGTAT
    ATTATCCTTATTTGTGGAGTCTCCAGGTCAATTGATTCAGAGGATCACCGATGACCCTGACGTTAGCATC
    AGGCTGTTAGAGGTTGTTCAGAGTGACCAGTCACAATCTGGCCTTACCTTCGCATCAAGAGGTACCAACA
    TGGAGGATGAGGCGGACCAATACTTTTCACATGATGATCCAAGCAGTAGTGATCAATCCAGGTCCGGATG
    GTTCGAGAACAAGGAAATCTCAGATATTGAAGTGCAAGACCCTGAGGGATTCAACATGATTCTGGGTACC
    ATTCTAGCCCAGATCTGGGTCTTGCTCGCAAAGGCGGTTACGGCCCCAGACACGGCAGCTGATTCGGAGC
    TAAGAAGGTGGATAAAGTACACCCAACAAAGAAGGGTAGTTGGTGAATTTAGATTGGAGAGAAAATGGTT
    GGATGTGGTGAGGAACAGGATTGCCGAGGACCTCTCTTTACGCCGATTCATGGTGGCTCTAATCCTGGAT
    ATCAAGAGGACACCCGGGAACAAACCTAGGATTGCTGAAATGATATGTGACATTGATACATATATCGTAG
    AGGCAGGATTAGCCAGTTTTATCCTGACTATTAAGTTTGGGATAGAAACTATGTATCCTGCTCTTGGACT
    GCATGAATTTGCTGGTGAGTTATCCACACTTGAGTCCTTGATGAATCTTTACCAGCAAATGGGAGAAACT
    GCACCCTACATGGTAATCCTAGAGAACTCAATTCAGAACAAGTTCAGTGCAGGATCATACCCTCTGCTCT
    GGAGCTATGCCATGGGAGTAGGAGTGGAACTTGAAAACTCCATGGGAGGTTTGAACTTTGGTCGATCTTA
    CTTTGATCCAGCATATTTTAGATTAGGGCAAGAGATGGTGAGGAGGTCAGCTGGAAAGGTCAGTTCCACA
    TTGGCATCCGAACTCGGTATCACTGCCGAGGATGCAAGGCTTGTTTCAGAGATTGCAATGCATACTACTG
    AGGACAGGATCAGTAGAGCGGTCGGACCCAGACAAGCCCAAGTGTCATTTCTACACGGTGATCAAAGTGA
    GAATGAGCTACCAGGATTGGGGGGCAAGGAAGATAGGAGGGTCAAACAGGGTCGGGGAGAAGCCAGGGAG
    AGCTACAGAGAAACCGGGTCCAGCAGAGCAAGTGATGCGAGAGCTGCCCATCCTCCAACCAGCATGCCCC
    TAGACATTGACACTGCATCGGAGTCAGGCCAAGATCCGCAGGACAGTCGAAGGTCAGCTGACGCCCTGCT
    CAGGCTGCAAGCCATGGCAGGAATCTTGGAAGAACAAGGCTCAGACACGGACACCCCTAGGGTATACAAT
    GACAGAGATCTTCTAGACTAGGTGCGAGAGGCCGAGGACCAGAACAACATCCGCCTACCCTCCATCATTG
    TTATAAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_056918.1 nucleocapsid protein [Measles morbillivirus]
    MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLT
    GALIGILSLFVESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPSSSD
    QSRSGWFENKEISDIEVQDPEGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFR
    LERKWLDVVRNRIAEDLSLRRFMVALILDIKRTPGNKPRIAEMICDIDTYIVEAGLASFILTIKFGIETM
    YPALGLHEFAGELSTLESLMNLYQQMGETAPYMVILENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGL
    NFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDARLVSEIAMHTTEDRISRAVGPRQAQVSFL
    HGDQSENELPGLGGKEDRRVKQGRGEARESYRETGSSRASDARAAHPPTSMPLDIDTASESGQDPQDSRR
    SADALLRLQAMAGILEEQGSDTDTPRVYNDRDLLD
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Lewis rats were immunized with recombinant vaccinia virus (VV) expressing various proteins of measles virus (MV). VVN (Nucleocapsid Protein) -immunized rats survived a MV challenge infection (Brinckmann et al., 1991).
  • Related Vaccine(s): Measles Virus Vaccine VVN
5. P phosphoprotein
  • Gene Name : P phosphoprotein
  • Sequence Strain (Species/Organism) : Measles morbillivirus
  • VO ID : VO_0011169
  • NCBI Gene ID : 1489805
  • NCBI Protein GI : 9626947
  • Locus Tag : MeVgp2
  • Genbank Accession : AB016162
  • Protein Accession : NP_056919
  • Taxonomy ID : 11234
  • Gene Starting Position : 1747
  • Gene Ending Position : 3401
  • Gene Strand (Orientation) : +
  • Protein Name : mRNA
  • Protein pI : 4.73
  • Protein Weight : 52011.09
  • Protein Length : 507
  • Protein Note : RNA editing; co-transcriptional insertion of a non-template G at nt 2499 of the 'P' protein transcript creates V mRNA
  • DNA Sequence : Show Sequence
    >NC_001498.1:1747-3401 Measles virus, complete genome
    TAGGAACCAGGTCCACACAGCCGCCAGCCAACCAACCATCCACTCCCACGACTGGAGCCGATGGCAGAAG
    AGCAGGCACGCCATGTCAAAAACGGACTGGAATGCATCCGGGCTCTCAAGGCCGAGCCCATCGGCTCACT
    GGCCGTCGAGGAAGCCATGGCAGCATGGTCAGAAATATCAGACAACCCAGGACAGGACCGAGCCACCTGC
    AAGGAAGAGGAGGCAGGCAGTTCGGGTCTCAGCAAACCATGCCTCTCAGCAATTGGATCAACTGAAGGCG
    GTGCACCTCGCATCCGCGGTCAGGGATCTGGAGAAAGCGATGACGACGCTGAAACTTTGGGAATCCCCTC
    AAGAAATCTCCAGGCATCAAGCACTGGGTTACAGTGTTATCATGTTTATGATCACAGCGGTGAAGCGGTT
    AAGGGAATCCAAGATGCTGACTCTATCATGGTTCAATCAGGCCTTGATGGTGATAGCACCCTCTCAGGAG
    GAGACGATGAATCTGAAAACAGCGATGTGGATATTGGCGAACCTGATACCGAGGGATATGCTATCACTGA
    CCGGGGATCTGCTCCCATCTCTATGGGGTTCAGGGCTTCTGATGTTGAAACTGCAGAAGGAGGGGAGATC
    CACGAGCTCCTGAAACTCCAATCCAGAGGCAACAACTTTCCGAAGCTTGGGAAAACTCTCAATGTTCCTC
    CGCCCCCGAACCCCAGTAGGGCCAGCACTTCCGAGACACCCATTAAAAAGGGCACAGACGCGAGATTGGC
    CTCATTTGGAACGGAGATCGCGTCTTTATTGACAGGTGGTGCAACCCAATGTGCTCGAAAGTCACCCTCG
    GAACCATCAGGGCCAGGTGCACCTGCGGGGAATGTCCCCGAGTGTGTGAGCAATGCCGCACTGATACAGG
    AGTGGACACCCGAATCTGGTACCACAATCTCCCCGAGATCCCAGAATAATGAAGAAGGGGGAGACTATTA
    TGATGATGAGCTGTTCTCCGATGTCCAAGACATCAAAACAGCCTTGGCCAAAATACACGAGGATAATCAG
    AAGATAATCTCCAAGCTAGAATCATTGCTGTTATTGAAGGGAGAAGTTGAGTCAATTAAGAAGCAGATCA
    ACAGGCAAAATATCAGCATATCCACCCTGGAAGGACACCTCTCAAGCATCATGATTGCCATTCCTGGACT
    TGGGAAGGATCCCAACGACCCCACTGCAGATGTCGAACTCAATCCCGACCTGAAACCCATCATAGGCAGA
    GATTCAGGCCGAGCACTGGCCGAAGTTCTCAAGAAGCCCGTTGCCAGCCGACAACTCCAGGGAATGACTA
    ATGGACGGACCAGTTCCAGAGGACAGCTGCTGAAGGAATTTCAACTAAAGCCGATCGGGAAAAAGGTGAG
    CTCAGCCGTCGGGTTTGTTCCTGACACCGGCCCTGCATCACGCAGTGTAATCCGCTCCATTATAAAATCC
    AGCCGGCTAGAGGAGGATCGGAAGCGTTACCTGATGACTCTCCTTGATGATATCAAAGGAGCCAACGATC
    TTGCCAAGTTCCACCAGATGCTGATGAAGATAATAATGAAGTAGCTACAGCTCAACTTACCTGCCAACCC
    CATGCCAGTCGACCTAATTAGTACAACCTAAATCCATTATAAAAA
    
    
  • Protein Sequence : Show Sequence
    >NP_056919.1 phosphoprotein [Measles morbillivirus]
    MAEEQARHVKNGLECIRALKAEPIGSLAVEEAMAAWSEISDNPGQDRATCKEEEAGSSGLSKPCLSAIGS
    TEGGAPRIRGQGSGESDDDAETLGIPSRNLQASSTGLQCYHVYDHSGEAVKGIQDADSIMVQSGLDGDST
    LSGGDDESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLKLQSRGNNFPKLGKTL
    NVPPPPNPSRASTSETPIKKGTDARLASFGTEIASLLTGGATQCARKSPSEPSGPGAPAGNVPECVSNAA
    LIQEWTPESGTTISPRSQNNEEGGDYYDDELFSDVQDIKTALAKIHEDNQKIISKLESLLLLKGEVESIK
    KQINRQNISISTLEGHLSSIMIAIPGLGKDPNDPTADVELNPDLKPIIGRDSGRALAEVLKKPVASRQLQ
    GMTNGRTSSRGQLLKEFQLKPIGKKVSSAVGFVPDTGPASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKG
    ANDLAKFHQMLMKIIMK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Lewis rats were immunized with recombinant vaccinia virus (VV) expressing various proteins of measles virus (MV). VVP (Phosphoprotein) -immunized rats were partially protected from MV challenge (Brinckmann et al., 1991).
  • Related Vaccine(s): Measles Virus Vaccine VVP
1. IFNG
  • Gene Name : IFNG
  • Sequence Strain (Species/Organism) : Macaca mulatta
  • NCBI Gene ID : 574282
  • NCBI Protein GI : 74136365
  • Locus Tag : EGK_03901
  • Genbank Accession : CM001263
  • Protein Accession : NP_001028077
  • Taxonomy ID : 9544
  • Chromosome No : 11
  • Gene Starting Position : 65143979
  • Gene Ending Position : 65148219
  • Gene Strand (Orientation) : -
  • Protein Name : interferon-gamma
  • Protein pI : 9.92
  • Protein Weight : 18339.63
  • Protein Length : 165
  • Protein Note : Also known as IFN-gamma
  • DNA Sequence : Show Sequence
    >gi|109156580:65143979-65148219 Macaca mulatta chromosome 11, Mmul_051212, whole genome shotgun sequence
    ATTATTGGGATGCTCTTCGACCTCGAAACATCTGACTCCTTTTTCGCTTCCCTATTTTAGCTGCTGGCGA
    CAGTTCAGCCATCACTTGGATGAGTTCATGTACTGCTTTGCGTTGGACATTTGAGTCAGTTACCTATTGG
    GAAAGAAAAGAGCAAAATTAATTTCAGGCATATAAGCCATCAGGATATTCAGTTAATGGCATGATGGTCA
    GTGAAAATAAAACTATTCCTTTAAAAAAATGGACCATATTACCTTAATATACAATATTTACTTCTTCAGC
    AGTTGAGGCTAAAAATTACAATTACATTACTAGTTGTGCAATGATGTGGTGGAGTCCGTCACATATCTTT
    AAATCTACTCCCATAGAATTCTTGAAATCATATAGTGAAAAGACCCCTGGTGTGGAGTCAATGTAAAAAG
    GTGGATCTGAATCTCATGCGTGCAATAATTCTGACCTTGAGCCAGCTACTTAACCTTTTGGAACCTCTAT
    TTTCTCATCTAAAGGAAGAGAAGACTGTTTCTATGACCTCTCTATCATCAATCTACCAATTATATCACTT
    TATACTTTAGTCTCTCCTGTATGTATCAAACGAGTAACTATAGGTCAATGATTCTCACTGTTGTGCATAG
    CAGATTAACCTGGAAACCTAATAAAGACCTCAGAGATCCAGGGGCACGAATTGGAAGGACTGTGCCCTGT
    GCATTCACTAAGCTCCCCAGGTGATTCTGACATCCACCTAAGTTTGAGAACCACTGATCTAGGTTAGGTA
    CCCTAGAAAACATCAAATCCAAAACAAGTGAAAACTGTAATTTTTAATTTCTCCCAGATTAGATCAGTCT
    CTCAATTTCCATAATAGGTTTTAAAATAACCACCAATCATATTTATATATGGCTTACTGATATATAAAGT
    TTAAAATTAGGAATTGCAACAACTTTTTCAGTACCCTACCTTCTAGGCCAGCAAATTGAACTACTTGCAT
    TTCCTCACTCTAACTAATAGGGCCATTTAGGTGATTTCATTCTTCCTAAAATGTGGACCATTTACTTTCC
    TCTTGACTCTGCCATTATATTTTTTCTAATCTTGGGAACACTATGGCTACCTCGCCACATTTCTGAGGAT
    GGCTGGGGGATTACAGGCTACAGAGCTAATTATGAAAGGGCATAACATACCTCAGCTTAGCAACTGAGCC
    AAAGAGAACAATAATTAATAGAGCTCACTCAAGATTGCCCATCAAGAAACAGGAGGTTTGTAGCTTCCAG
    AAGGAAGAAACCCACAGATTTTTTTTTCACTTTTTTAAGGCCCAGTTCCTGCGGAGTAGAAAAAGTTTTC
    TACAAGCTGTGTGTTTGCAAGTGACAGATTTTACTTTCCAGTGTTCAAATCATCACCAAGAAACTAAGAG
    ACTTATCCAGGACGGAACAGTAAGCCAGGGGCACCACTGGGTTGGTGGCAAGTGCTGAGTGTCTAGTTTC
    TAACCAAAGGAGACCTGTTGCCATGTCCCTCCTTTCAGTTTCTGGGGGTTCACATGAGAGGAGTGAGAGG
    CAGGCCCGGCAATAGTGAAAGCTGAGCACAAATCCTAAGAGCACAAATGCCAGCTTGAGCTCTCATTTGA
    GCCCATTTATATCAAAGCCAATCCCAAAGGAATCTAGAGGTCTTTGTCTTCTAGATAAAATTTTGAAAAA
    CGTGTTTTGTCTTTATGCCTCAATGTTATCTTTCTGTTTATAGAAGGCATAATTTAAAGATAATTTAAAG
    ATACAAGTTCATGAGGTATGACTTAGGAGTCTAAGGAGTTCTCCAGCTGAGATATTCTGAAAGTTGATAG
    AGACTTGATAGAACAATGTTTTCATAAGCTATAAATTCTACCTATTTTTCCCTAAAAACAAACAGCAACC
    ATTCTTGCTTCTAATTAGGCAGTACAATCTGATAGGTTGGCTAGAGAATTGCAGTGGGGTGCACTGGTAC
    CTACTCAAAGGCTGTAGCTTTCTTCTATCTCATTCTCATTTTCTATTCTTGGCATTGTAGAGTTTTGGAG
    CAAAGAATGTCATCAAACTTATGCAGTGAACCTAACAGTTTCCTTTTAAGATGAGGGCACTGAGCCCCAG
    CCAGCCATGTGATTCATCACAGTTCCCTGGTGGCTGAGATGGGAGGAGAACACACATCTTCTCAGCTCCT
    CCCACTGCTCTTTCCATTAAGACAGACAGCCTCTCATTCAAAGTAAGAGAATTTCCATCATATGAGCAAA
    GGACAATGAGAGAATTGCTTCTCAGTACTCCCCACTACTTCCTCACCTACTTCCTCTTCATTGGATTTGT
    CAATTCACCTGTCTTTACACAATAGTTACAATGCCAGCACTTTTCCTACATTACATACTTCAGTGATTCC
    CATACTGGCTTTGCAAAGTCATCCAAACACAAATAGAATTAGTAAGAGTTTCAGCTACGGGTTGAGTTCA
    TAGCTTTAGCAACTGTTAAATAGCTAATGTCTACTTTCTGGAGAACAAATGCTTTGCAAGACCTTCCGCA
    ATGAAACCAAAGAAAGAATTTAAAGAGCCTTACCGAATAATTGGTCAGCTTTTCAAAGTCATCCCGTTTC
    TTTTTGTTGCTATTGAAAAACTTGACATTAATGTCTTCCTTGATGGTCTCCACACTCTTTTGGATCCTCT
    GGTCATCTTTGAAGTTTTTAAAAAGTTTGAAGTAAAAGGAGACAATTTGGCTCTGCATTATTTTTCTGTC
    ACTCTCCTTGGAAGGAAAGAACACAAACAGAGGATGATGTGTATTTATCCATCAGAAAGCAAGCAACAGG
    AAAATTAGCCAAATGGGAATATTCAGCTTACCTCTTTCCAATTCCTCAAGATGTCTAAGAAAAGAGTTCC
    ATTATCTGCTACATCTGGATCACCTGCATTCTGGGGGAAAAAAAAGGGTTTACAATTAGCCCATAAATTG
    TCTTAAAAATATATTTCAAGTTTCATTAAACTCAGATGTGACAATATTCACTGATTTCCTTTTCAATTCT
    TCTGCTTAGTTCTAACAATAAGTGTTCACAAAATGTTTATGTGAGATATAGCCAAAGACTACTATGCTCT
    TTTAGCTTTTTTATTTTCCAACATAACCATTAAATTGCAATGTCACAAAGGAGTTAAACAAAGCTGATGA
    TACTCCAAGGGTCTCAAAAACTATAGTAGGCTAAAGAAAGTATTTTCAAGCTAGGCTAAAAAATACAGAA
    CAAAAAACAGCAAAGCCACCCCACTATAAAATACTGCCCCCCAATGGCACAGGTTTCTATTACATCTACT
    ATGCCTTCCTGTAGGGTATTATGTCAACTTTAAAAGATAGTTCCAAACGTGTGCGTGCGTGTGTGTGTGT
    GTGTGTGTGTGTGGTCTGATTTTGTGTTGTAGGAATAAAATTAATTGTGAATGTCTGAATATTAGTATGA
    CAGCTATAATTATAACTAAGTTTTAAATAAATAATGAAATATTTAAAATGTAAAAACTTTTCATTAACCA
    TCAATAAAATTTTAAAAGAAACTCAAAAAACTCACTTAAAATTTTTAAACATTCCATAGCCAGAATCATA
    ATTCCTACAAAATCCCAGTGAGCAACTAAGTTCAGGAGTAATTCACAAGGAATATAGATAGAGCAGCAGA
    ATGTTGAAATAACTTTTTGGAGAAAATCACCTATCAGTGATTTTTTTTAAGCCAAAACTTTAAGGACCTT
    TTTTACTTTAATTTGTAAACGTTTCCTATTAACTTTTGAATGCTAATCTTGACCTTAGAGTCTGAGAAGT
    CAAAAACTAATAGCCAATCATTTTTTTCAATATGCATACTCCTTGACTTATCACATCTGAATGAGTTCTC
    ACCACAAAATTATTAACATCATTATGCTTCATATCCATATTATGCCCATCTTTGGGAAGATTCATAAATC
    CCTTTTAAGTCTCTATACAAACTGAGCAGAAGGTTAAAACAATATCTAGATTATGTAGTCAAGAAACTCA
    TCCAGTCAATAATTAACAAAATAAAACCAGATCTCAAAATGACTGCGTACGAGAGGACAGTCTATCAGAG
    ATGCTACAGCAAGTCAATATTCAGACATTTTCAACCACAAAAAAGTACTATTAAAAAGCCATACTTACAA
    AATATTTCTTAAGGTTTTCTGCTTCTTTTACATATGGGTCCTGGCAGTAACAGCCAAGAGAACCCAAAAC
    AATGCAGAGCTGAAAAGCCAAGATATAACTTGTGTATTTCA
  • Protein Sequence : Show Sequence
    >gi|74136365|ref|NP_001028077.1| interferon gamma precursor [Macaca mulatta]
    MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQS
    QIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVM
    AELSPAAKIGKRKRSQMFRGRRASQ
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Measles Virus vaccine VEE/SIN-H+F
IV. Vaccine Information
1. ALVAC-MV-HA/F
a. Vaccine Ontology ID:
VO_0004741
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of F fusion protein
  • Type: Recombinant vector construction
  • Description: Canarypox virus (CPV) recombinants expressing the hemagglutinin (HA) and fusion (F) glycoproteins of measles virus (MV) (Taylor et al., 1992).
  • Detailed Gene Information: Click here.
f. Gene Engineering of H hemagglutinin protein
  • Type: Recombinant vector construction
  • Description: Canarypox virus (CPV) recombinants expressing the hemagglutinin (HA) and fusion (F) glycoproteins of measles virus (MV) (Taylor et al., 1992).
  • Detailed Gene Information: Click here.
g. Preparation
Canarypox virus (CPV) recombinants expressing the hemagglutinin (HA) and fusion (F) glycoproteins of measles virus (MV) (Taylor et al., 1992).
h. Immunization Route
Intramuscular injection (i.m.)
i. Dog Response
  • Vaccination Protocol: Vaccinate the dogs with recombinant vaccine (Taylor et al., 1992).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Lethal does of canine distember virus (CDV) (Taylor et al., 1992).
  • Efficacy: The recombinants elicited a protective immune response. The level of MV neutralizing antibodies and the level of protection induced against CDV challenge achieved by the host-restricted CPV vector were equivalent to that obtained by vaccinia virus vectors expressing the same MV antigens (Taylor et al., 1992).
2. Attenuvax
a. Product Name:
Measles Virus Vaccine Live
b. Tradename:
Attenuvax
c. Manufacturer:
Merck & Co., Inc, USA License #0002
d. Vaccine Ontology ID:
VO_0000007
e. Type:
Live, attenuated vaccine
f. Status:
Licensed
g. Location Licensed:
USA (License #0002)
h. Host Species for Licensed Use:
Human
i. Antigen
A more attenuated line of measles virus derived from Enders' attenuated Edmonston strain
j. Preparation
ATTENUVAX is a sterile lyophilized preparation of a more attenuated line of measles virus derived from Enders' attenuated Edmonston strain and propagated in chick embryo cell culture (FDA: Attenuvax).
k. Immunization Route
Intradermal injection (i.d.)
l. Storage
The vaccine must be maintained at a temperature of 10°C (50°F) or colder.
m . Approved Age for Licensed Use
12 months and older
n. Contraindication
Hypersensitivity to any component of the vaccine, including gelatin, ATTENUVAX should not be administered to persons with a history of anaphylactic, anaphylactoid or other immediate reactions (e.g., hives, swelling of the mouth and throat, difficulty breathing, hypotension and shock) subsequent to egg ingestion.
o. Description
ATTENUVAX is a live virus vaccine for vaccination against measles (rubeola).
p. Human Response
  • Immune Response: A single injection of the vaccine has been shown to induce measles hemagglutination-inhibition (HI) antibodies in 97% or more of susceptible persons (FDA: Attenuvax).
  • Side Effects: Side effects of vaccination include: fever, headache. dizziness, redness, soreness and swelling at the injection site.
3. Canine Distemper-Adenovirus Type 2-Measles-Parainfluenza Modified Live Virus Vaccine (USDA: 1341.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002095
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
4. Canine Distemper-Measles Modified Live Virus Vaccine (USDA: 1351.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002096
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
5. Eolarix
a. Tradename:
Eolarix
b. Manufacturer:
GlaxoSmithKline
c. Vaccine Ontology ID:
VO_0010712
d. Type:
Live, attenuated vaccine
e. Status:
Licensed
f. Location Licensed:
Canada
g. Host Species for Licensed Use:
Human
h. Allergen:
Neomycin
i. Immunization Route
Subcutaneous injection
j. Storage
2 to 8°C (36 to 46°F) or colder. Do not freeze.
k . Approved Age for Licensed Use
1 year and older
l. Description
Products: Live virus. Other components: Human albumin, Lactose, Dextran.
6. M-M-R II
a. Tradename:
M-M-R II
b. Manufacturer:
Merck Frosst
c. Vaccine Ontology ID:
VO_0000069
d. CDC CVX code:
03
e. Type:
Live vaccine
f. Status:
Licensed
g. Location Licensed:
Canada
h. Host Species for Licensed Use:
Human
i. Allergen:
Gelatin, Neomycin, Residual components of chick embryo cell cultures
j. Immunization Route
Subcutaneous injection
k. Description
Products: Live virus. Other components: Bovine serum, Glutamate, Yeast-derived, recombinant Human albumin, Residual protein, from cell culture, Sorbitol, Sucrose.
7. Measles Virus vaccine VEE/SIN-H
a. Vaccine Ontology ID:
VO_0004187
b. Type:
Recombinant vector vaccine
c. Status:
Licensed
d. Gene Engineering of H hemagglutinin protein
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
Chimeric Venezuelan equine encephalitis/Sindbis virus (VEE/SIN) replicon particles (Pan et al., 2010).
f. Immunization Route
Intradermal injection (i.d.)
g. Monkey Response
  • Host Strain: Rhesus macaques
  • Vaccination Protocol: Juvenile rhesus macaques were vaccinated with a single intradermal (i.d.) injection of 108 VEE/SIN-H particles or 108 VEE/SIN-H particles plus 3 x 106 VEE/SIN-F particles (VEE/SIN-H+F). Two juvenile monkeys were vaccinated with one dose of 5,000 PFU of the Moraten strain of LAV intramuscularly (i.m.). Two juvenile monkeys were vaccinated with three doses of 0.5 ml of FIMV i.m. at 0, 4, and 8 weeks. Three infant rhesus macaques were immunized i.d. with 108 VEE/SIN-H particles plus 3 x 106 VEE/SIN-F particles and boosted 2 months later (Pan et al., 2010)
  • Challenge Protocol: For MV challenge, 104 tissue culture 50% infectious doses (TCID50) of the Bilthoven strain of MV were instilled intratracheally into anesthetized animals 12 to 17 months after vaccination. Monkeys were shaved and monitored frequently for development of a rash (Pan et al., 2010).
  • Efficacy: Neutralizing antibody remained above the protective level for more than 1 year after vaccination with VEE/SIN-H, VEE/SIN-H+F, or LAV. When challenged with wild-type MV 12 to 17 months after vaccination, all vaccinated juvenile and infant monkeys vaccinated with VEE/SIN-H, VEE/SIN-H+F, and LAV were protected from rash and viremia, while FIMV-vaccinated monkeys were not (Pan et al., 2010).
8. Measles Virus vaccine VEE/SIN-H+F
a. Vaccine Ontology ID:
VO_0011422
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of F fusion protein
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
e. Gene Engineering of H hemagglutinin protein
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
chimeric Venezuelan equine encephalitis/Sindbis virus (VEE/SIN) replicon particles (Pan et al., 2010).
g. Immunization Route
Intradermal injection (i.d.)
h. Monkey Response
  • Host Strain: Rhesus macaques
  • Vaccination Protocol: Juvenile rhesus macaques were vaccinated with a single intradermal (i.d.) injection of 108 VEE/SIN-H particles or 108 VEE/SIN-H particles plus 3 x 106 VEE/SIN-F particles (VEE/SIN-H+F). Two juvenile monkeys were vaccinated with one dose of 5,000 PFU of the Moraten strain of LAV intramuscularly (i.m.). Two juvenile monkeys were vaccinated with three doses of 0.5 ml of FIMV i.m. at 0, 4, and 8 weeks. Three infant rhesus macaques were immunized i.d. with 108 VEE/SIN-H particles plus 3 x 106 VEE/SIN-F particles and boosted 2 months later (Pan et al., 2010).
  • Challenge Protocol: For MV challenge, 104 tissue culture 50% infectious doses (TCID50) of the Bilthoven strain of MV were instilled intratracheally into anesthetized animals 12 to 17 months after vaccination. Monkeys were shaved and monitored frequently for development of a rash (Pan et al., 2010).
  • Efficacy: Neutralizing antibody remained above the protective level for more than 1 year after vaccination with VEE/SIN-H, VEE/SIN-H+F, or LAV. When challenged with wild-type MV 12 to 17 months after vaccination, all vaccinated juvenile and infant monkeys vaccinated with VEE/SIN-H, VEE/SIN-H+F, and LAV were protected from rash and viremia, while FIMV-vaccinated monkeys were not (Pan et al., 2010).
  • Host Gene Response of IFNG
    • Gene Response: VEE/SIN-H+F vaccinated rhesus macaques showed a significant increase in IFN-gamma producing cells in blood 1 to 2 weeks after vaccination as compared to the current live attenuated virus vaccine (LAV). The significant increase came after stimulation with the measles H-peptide (Pan et al., 2010).
    • Detailed Gene Information: Click here.
9. Measles Virus Vaccine VVM
a. Vaccine Ontology ID:
VO_0011537
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of M matrix protein
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
Vaccinia Virus (Brinckmann et al., 1991).
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Rat Response
  • Host Strain: Lewis
  • Vaccination Protocol: To determine the protective effect of individual measles virus (MV) proteins, 2- to 3-week-old suckling rats were immunized either once, twice or three times at 5 to 7 day intervals by i.p. injections of 107 p.f.u, of recombinant vaccinia virus (VV) expressing individual structural proteins or VV-wt (Brinckmann et al., 1991).
  • Challenge Protocol: Three to 5 days after the last recombinant VV injection, the animals were challenged by intracerebral (i.c.) infection with the neurotropic rat brain-adapted MV strain CAM/RBH (0.5 × 104 to 8 x 10 ~ TCID50) (Brinckmann et al., 1991).
  • Efficacy: Lewis rats were immunized with recombinant vaccinia virus (VV) expressing various proteins of measles virus (MV). VVM (Matrix Protein) -immunized rats were partially protected from MV challenge (Brinckmann et al., 1991).
10. Measles Virus Vaccine VVN
a. Vaccine Ontology ID:
VO_0011535
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of N nucleocapsid protein
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
Vaccinia virus (Brinckmann et al., 1991).
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Rat Response
  • Host Strain: Lewis
  • Vaccination Protocol: To determine the protective effect of individual measles virus (MV) proteins, 2- to 3-week-old suckling rats were immunized either once, twice or three
    times at 5 to 7 day intervals by i.p. injections of 107 p.f.u, of recombinant vaccinia virus (VV) expressing individual structural proteins or VV-wt (Brinckmann et al., 1991).
  • Challenge Protocol: Three to 5 days after the last recombinant VV injection, the animals were challenged by intracerebral (i.c.) infection with the neurotropic rat brain-adapted MV strain CAM/RBH (0.5 × 104 to 8 x 10 ~ TCID50) (Brinckmann et al., 1991).
  • Efficacy: Rats immunized with recombinant VVN survived a MV challenge infection (Brinckmann et al., 1991).
11. Measles Virus Vaccine VVP
a. Vaccine Ontology ID:
VO_0011536
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of P phosphoprotein
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
Vaccinia virus (Brinckmann et al., 1991).
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Rat Response
  • Host Strain: Lewis
  • Vaccination Protocol: To determine the protective effect of individual measles virus (MV) proteins, 2- to 3-week-old suckling rats were immunized either once, twice or three times at 5 to 7 day intervals by i.p. injections of 107 p.f.u, of recombinant vaccinia virus (VV) expressing individual structural proteins or VV-wt (Brinckmann et al., 1991).
  • Challenge Protocol: Three to 5 days after the last recombinant VV injection, the animals were challenged by intracerebral (i.c.) infection with the neurotropic rat brain-adapted MV strain CAM/RBH (0.5 × 104 to 8 x 10 ~ TCID50) (Brinckmann et al., 1991).
  • Efficacy: Lewis rats were immunized with recombinant vaccinia virus (VV) expressing various proteins of measles virus (MV). VVP (Phosphoprotein) -immunized rats were partially protected from MV challenge (Brinckmann et al., 1991).
12. Priorix
a. Tradename:
Priorix
b. Manufacturer:
GlaxoSmithKline
c. Vaccine Ontology ID:
VO_0010734
d. Type:
Live, attenuated vaccine
e. Status:
Licensed
f. Location Licensed:
Canada
g. Host Species for Licensed Use:
Human
h. Allergen:
Neomycin
i. Immunization Route
Subcutaneous injection
j. Storage
Store at at 2 to 8°C.
k . Approved Age for Licensed Use
1 year and older (GSK: Priorix)
l. Description
Products: Live virus. Other components: Lactose.
13. Priorix-Tetra
a. Tradename:
Priorix-Tetra
b. Manufacturer:
GlaxoSmithKline
c. Vaccine Ontology ID:
VO_0010735
d. Type:
Live, attenuated vaccine
e. Status:
Licensed
f. Location Licensed:
Canada
g. Host Species for Licensed Use:
Human
h. Allergen:
Neomycin
i. Immunization Route
Subcutaneous injection
j. Storage
Store at at 2 to 8°C. Do not freeze (GSK: Priorix-Tetra).
k . Approved Age for Licensed Use
9 months to 6 years (GSK: Priorix-Tetra)
l. Description
Products: Live virus. Other components: Lactose.
14. ProQuad
a. Product Name:
Measles, Mumps, Rubella and Varicella Virus Vaccine Live
b. Tradename:
ProQuad
c. Manufacturer:
Merck & Co, Inc.
d. Vaccine Ontology ID:
VO_0000091
e. CDC CVX code:
94
f. Type:
Live, attenuated vaccine
g. Status:
Licensed
h. Location Licensed:
USA (License #0002)
i. Host Species for Licensed Use:
Human
j. Preparation
propagated in chick embryo cell culture.
k. Immunization Route
Intramuscular injection (i.m.)
l. Storage
maintained at a temperature of 2° to 8°C (36° to 46°F) or colder.
m . Approved Age for Licensed Use
12 months to 12 years old
n. Contraindication
Vaccine should not be administered to anyone with a known history of anaphylactic reactions to neomycin, or to anyone with a history of hypersensitivity to gelatin or any other component of the vaccine (FDA: ProQuad).
o. Description
ProQuad is a sterile lyophilized preparation of (1) the components of M-M-R*II (Measles, Mumps and Rubella Virus Vaccine Live): Measles Virus Vaccine Live, a more attenuated line of measles virus, derived from Enders' attenuated Edmonston strain and propagated in chick embryo cell culture; Mumps Virus Vaccine Live, the Jeryl Lynn™ (B level) strain of mumps virus propagated in chick embryo cell culture; Rubella Virus Vaccine Live, the Wistar RA 27/3 strain of live attenuated rubella virus propagated in WI-38 human diploid lung fibroblasts; and (2) Varicella Virus Vaccine Live (Oka/Merck) refrigerator-stable formulation, the Oka/Merck strain of varicella-zoster virus propagated in MRC-5 cells (FDA: ProQuad).
p. Human Response
  • Immune Response: According to clinical trials, there were high levels of antibodies in 98.9% of those vaccinated after a single dose of Proquad (FDA: ProQuad).
  • Side Effects: Side effects of vaccination include: injection site reactions, fever, irritability and diarrhea.
V. References
1. Brinckmann et al., 1991: Brinckmann UG, Bankamp B, Reich A, ter Meulen V, Liebert UG. Efficacy of individual measles virus structural proteins in the protection of rats from measles encephalitis. The Journal of general virology. 1991; 72 ( Pt 10); 2491-2500. [PubMed: 1833505].
2. Drillien et al., 1988: Drillien R, Spehner D, Kirn A, Giraudon P, Buckland R, Wild F, Lecocq JP. Protection of mice from fatal measles encephalitis by vaccination with vaccinia virus recombinants encoding either the hemagglutinin or the fusion protein. Proceedings of the National Academy of Sciences of the United States of America. 1988; 85(4); 1252-1256. [PubMed: 3422488].
3. FDA: Attenuvax: FDA: Attenuvax information [http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm203032.htm]
4. FDA: MMR-II: FDA: MMR-II [http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm094050.htm]
5. FDA: ProQuad: FDA: ProQuad Vaccine [http://www.fda.gov/BiologicsBloodVaccines/Vaccines/ApprovedProducts/ucm094051.htm]
6. Griffin et al., 2008: Griffin DE, Pan CH, Moss WJ. Measles vaccines. Frontiers in bioscience : a journal and virtual library. 2008; 13; 1352-1370. [PubMed: 17981635].
7. GSK: Priorix: GSK: Priorix Product Information [http://www.gsk.ca/english/docs-pdf/Priorix_PM_20081103_EN.pdf]
8. GSK: Priorix-Tetra: GSK: Priorix-Tetra Product Information [http://www.gsk.ca/english/docs-pdf/Priorix-Tetra_PM_20090908_EN.pdf]
9. Martinez et al., 1997: Martinez X, Brandt C, Saddallah F, Tougne C, Barrios C, Wild F, Dougan G, Lambert PH, Siegrist CA. DNA immunization circumvents deficient induction of T helper type 1 and cytotoxic T lymphocyte responses in neonates and during early life. Proceedings of the National Academy of Sciences of the United States of America. 1997; 94(16); 8726-8731. [PubMed: 9238045].
10. Pan et al., 2010: Pan CH, Greer CE, Hauer D, Legg HS, Lee EY, Bergen MJ, Lau B, Adams RJ, Polo JM, Griffin DE. A chimeric alphavirus replicon particle vaccine expressing the hemagglutinin and fusion proteins protects juvenile and infant rhesus macaques from measles. Journal of virology. 2010; 84(8); 3798-3807. [PubMed: 20130066].
11. Spreng et al., 2000: Spreng S, Gentschev I, Goebel W, Weidinger G, ter Meulen V, Niewiesk S. Salmonella vaccines secreting measles virus epitopes induce protective immune responses against measles virus encephalitis. Microbes and infection / Institut Pasteur. 2000; 2(14); 1687-1692. [PubMed: 11137042].
12. Wiki: Measles: Wiki: Measles [http://en.wikipedia.org/wiki/Measles]
13. Yanagi et al., 2006: Yanagi Y, Takeda M, Ohno S. Measles virus: cellular receptors, tropism and pathogenesis. The Journal of general virology. 2006; 87(Pt 10); 2767-2779. [PubMed: 16963735].