VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Pseudorabies virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. GB (Protective antigen)
    2. GI (Protective antigen)
    3. GII (Protective antigen)
    4. GIII (Protective antigen)
    5. Gp50 (Protective antigen)
    6. IE180 (Protective antigen)
    7. UL44 (Protective antigen)
    8. US6 (Protective antigen)
    9. glycoprotein E (Virmugen)
    10. glycoprotein G (Virmugen)
    11. glycoprotein M (Virmugen)
    12. gp50 (Virmugen)
    13. gp63 (Virmugen)
    14. UL23 (Virmugen)
    15. UL50 (Virmugen)
    16. US3 (Virmugen)
  3. Vaccine Related Host Genes
    1. Ifng (Interferon gamma)
    2. Il2
    3. Il4 (interleukin 4)
  4. Vaccine Information
    1. NYVAC-PRV- gII/ gp50
    2. Pseduorabies Subunit Glycoprotein C Vaccine
    3. Pseudorabies Modified Live Virus Vaccine (USDA: 1891.20)
    4. Pseudorabies Modified Live Virus Vaccine (USDA: 1891.22)
    5. Pseudorabies Modified Live Virus Vaccine (USDA: 1891.R2)
    6. Pseudorabies Modified Live Virus Vaccine (USDA: 1891.R4)
    7. Pseudorabies recombinant vector vaccine encoding gp50 and gII protein
    8. Pseudorabies recombinant vector vaccine encoding gp50 protein
    9. Pseudorabies Subunit gB Protein Vaccine
    10. Pseudorabies Subunit gI Protein Vaccine
    11. Pseudorabies virus glycoprotein E/G/UL23 mutant vaccine
    12. Pseudorabies virus gp50/gp63 mutant vaccine
    13. Pseudorabies virus UL50 mutant vaccine
    14. Pseudorabies virus US3 mutant vaccine
    15. Psuedorabies DNA vaccine encoding IE180 protein
    16. Psuedorabies virus glycoprotein M mutant vaccine
    17. rORFV-PRV-gC/gD
    18. Suvaxyn Aujeszky
  5. References
I. General Information
1. NCBI Taxonomy ID:
10345
2. Disease:
Aujeszky's disease
3. Introduction
Pseudorabies is a viral disease in swine that is endemic in most parts of the world. It is caused by porcine herpesvirus 1, which is also called pseudorabies virus (PRV) or suid herpesvirus-1 (SHV-1) and is also known as Aujeszky's disease, and in cattle as mad itch. PRV is considered to be the most economically important viral disease of swine in areas where hog cholera has been eradicated. Other domestic and wild mammals, such a cattle, sheep, dogs, raccoons are also susceptible. The disease is usually fatal in these hosts. The virus is shed in the saliva and nasal secretions of infected swine and is spread through oral or nasal contact. Aerosolization of the virus and transmission by fomites also may occur. The virus may potentially survive for seven hours in humid air and spread up to two kilometers. Furthermore, it may survive on well water for up to seven hours, in green grass, soil, and feces for up to two days, in contaminated feed for up to three days, and in straw bedding for up to four days (Wiki: Pseudorabies).
4. Microbial Pathogenesis
After natural infection, the primary site of viral replication is nasal, pharyngeal, or tonsillar epithelium. The virus spreads via the lymphatics to regional lymph nodes, where replication continues. Virus also spreads via nervous tissue to the brain, where it replicates, preferentially in neurons of the pons and medulla. In addition, virus has been isolated from alveolar macrophages, bronchial epithelium, spleen, lymph nodes, trophoblasts, embryos, and luteal cells (Merck Vet Manual: Pseudorabies).
5. Host Ranges and Animal Models
Although the pig is the only natural host, the virus can infect cattle, sheep, cats, dogs, and goats as well as wildlife, including raccoons, opossums, skunks, and rodents. Experimental studies in nonhuman primates indicate that rhesus monkeys and marmosets are susceptible but chimpanzees are not. Reports of human infection are limited and are based on seroconversion rather than virus isolation. Infections in horses are rare (Merck Vet Manual: Pseudorabies).
1. GB
  • Gene Name : GB
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • VO ID : VO_0011238
  • NCBI Protein GI : 4138504
  • Other Database IDs : UniProtKB/TrEMBL: Q9WJ33
  • Taxonomy ID : 10345
  • Gene Starting Position : 16807
  • Gene Ending Position : 19721
  • Gene Strand (Orientation) : -
  • Protein Name : envelope glycoprotein B
  • Protein Length : 8
  • Protein Note : strains Kaplan (Ka), Becker (Be), Rice, Indiana-Funkhauser (In-Fh), NIA-33 and TNL
  • Protein Sequence : Show Sequence
    >gi|4138504|emb|CAA09075.1| gB [Suid herpesvirus 1]
    ESEDPDAL
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Recombinant adenovirus expressing gB (rAd-gB) was found to induce effective protective immunity against a virulent viral infection, regardless of whether it was administered via the muscular or systemic route (Han et al., 2008).
  • Related Vaccine(s): Pseudorabies Subunit gB Protein Vaccine
2. GI
  • Gene Name : GI
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • VO ID : VO_0011251
  • NCBI Protein GI : 255957222
  • Other Database IDs : CDD:165544
  • Taxonomy ID : 10345
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein gI
  • Protein Length : 361
  • Protein Note : envelope glycoprotein I; Provisional; PHA03287
  • Protein Sequence : Show Sequence
    >gi|255957222|gb|ACU43467.1| envelope glycoprotein gI [Suid herpesvirus 1]
    RDVTRLPAGLLLAALTLAALTPRVGGVLFRGAGVSVHVAGSAVLVPGDAPNLTIDGTLLFLEGPSPSNYS
    GRVELLRLDPKRACYTREYAAEYDLCPRVHHEAFRGCLRKREPLARRASAAVEARRLLFVSRPAPPDAGS
    YVLRVRVNGTTDLFVLTALVPPRGRPHHPTPSSADECRPVVGSWHDSLRAVDPAEDAVFTTQPPPEPEPP
    TTPAPPRGTGATPEPRSDEEEEDEEGATTAMTPAPGTLDANGTMVLNASVVSRVLLAAANATAGARGPGK
    IAMVLGPTIVVLLIFLGGVACAARRCARNRIYRPRPGRGPAVHAPPPRRPPPSPVAGAPVPQPKMTLAEL
    RQKLATIAEEQ
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Vaccination of mice with fusion proteins containing the N terminus of gI from Suid herpesvirus 1 are able to confer protection to mice against a lethal challenge of PRV (Fuchs et al., 1990).
  • Related Vaccine(s): Pseudorabies Subunit gI Protein Vaccine
3. GII
  • Gene Name : GII
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • VO ID : VO_0011249
  • NCBI Protein GI : 1335775
  • Other Database IDs : CDD:165490
    CDD:144263
  • Taxonomy ID : 10345
  • Gene Strand (Orientation) : ?
  • Protein Name : glycoprotein gII
  • Protein Length : 133
  • Protein Note : glycoprotein BALF4; Provisional; PHA03231
  • Protein Sequence : Show Sequence
    >gi|1335775|gb|AAB26946.1| glycoprotein gII [Suid herpesvirus 1]
    PFGALAIGLLVLAGLVAAFLAYRHISRLRRNPMKALYPVTTKALKEDGVEEGDVDEAKLDQARDMIRYMS
    IVSALEQQEHRRARRTAGPRSWPAGSGRWLRAAGTTSASRARTPTPCSPLPRETIKMRLFGNT
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A NYVAC vaccinia vector containing genes for pseudorables virus glycoproteins gII and gp50 was administered to pigs to determine if it would have a greater protective effect than a vector containing the gene for gp50 alone. Both NYVAC vectors protected pigs similarly from virulent pseudorabies virus challenge (Brockmeier and Mengeling, 1996).
  • Related Vaccine(s): NYVAC-PRV- gII/ gp50 , Pseudorabies recombinant vector vaccine encoding gp50 and gII protein
4. GIII
  • Gene Name : GIII
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • VO ID : VO_0011250
  • NCBI Protein GI : 334050
  • Other Database IDs : CDD:165525
  • Taxonomy ID : 10345
  • Gene Strand (Orientation) : ?
  • Protein Name : glycoprotein gIII mature peptide
  • Protein Length : 479
  • Protein Note : glycoprotein gIII signal peptide
  • Protein Sequence : Show Sequence
    >gi|334050|gb|AAA47464.1| glycoprotein gIII [Suid herpesvirus 1]
    MASLARAMLALLALYAAAIAAAPSTTTALDTTPNGGGGGNSSEGELSPSPPPTPAPASPEAGAVSTPPVP
    PPSVSRRKPPRNNNRTRVHGDKATAHGRKRIVCRERLFSARVGDAVSFGCAVFPRAGETFEVRFYRRGRF
    RSPDADPEYFDEPPRPELPRERLLFSSANASLAHADALAPVVVEGERATVANVSGEVSVRVAAADAETEG
    VYTWRVLSANGTEVRSANVSLLLYSQPEFGLSAPPVLFGEPFRAVCVVRDYYPRRSVRLRWFADEHPVDA
    AFVTNSTVADELGRRTRVSVVNVTRADVPGLAAADAADALAPSLRCEAVWYRDSVASQRFSEALRPHVYH
    PAAVSVRFVEGFAVCDGLCVPPEARLAWSDHAADTVYHLGACAEHPGLLNVRSARPLSDLDGPVDYTCRL
    EGLPSQLPVFEDTQRYDASPASVSWPVVSSMIVVIAGIGILAIVLVIMATCVYYRQAGP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized with either gII, gIII, gVI antigen or a mixture of them were challenged intraperitoneally with 8.5 x 10(3) plaque forming units of PRV. All the mice immunized with 1.5 and 4.5 micrograms of the mixture and 4.5 micrograms of the gIII antigen survived (Matsuda et al., 1992).
5. glycoprotein E
  • Gene Name : glycoprotein E
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • NCBI Protein GI : 307634504
  • Other Database IDs : CDD:177575
    CDD:190321
  • Taxonomy ID : 10345
  • Gene Strand (Orientation) : ?
  • Protein Name : glycoprotein E
  • Protein Length : 578
  • Protein Note : envelope glycoprotein E; Provisional
  • Protein Sequence : Show Sequence
    >gi|307634504|gb|ADN78283.1| glycoprotein E [Suid herpesvirus 1]
    MRPFLLRAAQLLALLALALSTEAPSLSAETTPGPVTEVPSPSVEVWDDLSTEAGDDDLNGDLDGDDRRAG
    FGSALASLREAPPAHLVNVSEGANFTLDARGDGAVLAGIWTFLPVRGCDAVSVTTACFETACHPDLVLGR
    ACVPEAPEMGIGDYLPPEVPRLRREPPIVTPERWSPHLSVLRATPNDTGLYTLHDASGPRAVFFVAVGDR
    PPAPADPVGPARHEPRFHALGFHSQLFSPGDTFDLMPRVVSDMGDSRENFTATLDWYYARAPPRCLLYYA
    YEPCIYHPRAPECLRPVDPACSFTSPARARLVARRAYASCSPLLGDRWLTACPFDAFGEEVHTNATADES
    GLYVLVMTHNGHVATWDYTLVATAAEYVTVIKELTAPARAPGTPWGPGGGDDPIYVDGVTTPAPPARPWN
    PYGRTTPGRLFVLALGSFVMTCVVGGAVWLCVLCSRRRAASRPFRVPTRARTHMLSPVYTSLPTHEDYYD
    GDDDDEEAGVIRRRPASPGGDSGYEGSYASLDPEDEFSSDEDNGLYVRPEEAPRSGFDVWFRDPEKPEVT
    NGPNYGVTANRLLNARPA
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A glycoprotein E mutant, in combination with UL23 and glycoprotein G mutations, is attenuated in raccoons, with a 75% survival rate. This mutant also provides some protection from wild type PRV (Weigel et al., 2003).
  • Related Vaccine(s): Pseudorabies virus glycoprotein E/G/UL23 mutant vaccine , rORFV-PRV-gC/gD
6. glycoprotein G
  • Gene Name : glycoprotein G
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • NCBI Protein GI : 15422177
  • Other Database IDs : CDD:186820
  • Taxonomy ID : 10345
  • Gene Strand (Orientation) : ?
  • Protein Name : glycoprotein G
  • Protein Length : 499
  • Protein Note : Herpesvirus glycoprotein D/GG/GX domain; cl08328
  • Protein Sequence : Show Sequence
    >gi|15422177|gb|AAK95859.1| glycoprotein G [Suid herpesvirus 1]
    MKWATWILALGLLVVRTVVAREAPRELCYGHPVHDDRRPVGPATDAQPVNPLAPANATGTDYSRGCEMRL
    LDPPLDVSSRSSDPVNVTVAWFFDGGHCKVPLVHREYYGCPGDAMPSVETCTGGYSYTRTRIDTLMEYAL
    VNASLVLQPGLYDAGLYIVVLVFGDDAYLGTVSLSVEANLDYPCGMKHGLTITRPGATLPPIAPTAGDHQ
    RWRGCFPSTDEGAWENVTAAEKGLSDDYADYYDVHIFRLESDDEVVHGDAPEAPEGEEVTEEEAELTSSD
    LDNIEIEVVGSPAAPVEGAGDGEEGHGDEEDEELTSSDLDNIEIEVVGSPAAARFFAASTTPRAPTRAAE
    ITTMTTVTTVRTTEDPSGITDCRRSDFVSPSDIFVTPTGSPALLLGFLGSALASRPLHLTAGETAQHVRE
    AQQKSRHVRSLGGLQLSVETETTNTTTTQTGLSGDIRTSIYICVALAGLVVVGIVIMCLHMAIIRARARN
    DGYRHVASA
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A glycoprotein G mutant, in combination with UL23 and glycoprotein E mutations, is attenuated in raccoons, with a 75% survival rate. This mutant also provides some protection from wild type PRV (Weigel et al., 2003).
  • Related Vaccine(s): Pseudorabies virus glycoprotein E/G/UL23 mutant vaccine
7. glycoprotein M
  • Gene Name : glycoprotein M
  • NCBI Protein GI : 1478255
  • Other Database IDs : CDD:177566
    GOA:Q85041
    InterPro: IPR000785
    UniProtKB/UniProt: Q85041
  • Taxonomy ID : 33703
  • Gene Strand (Orientation) : ?
  • Protein Name : UL10
  • Protein Length : 525
  • Protein Note : envelope glycoprotein M; Provisional
  • Protein Sequence : Show Sequence
    >gi|1478255|emb|CAA65905.1| UL10 [Suid herpesvirus 1 strain Kaplan]
    MTYASESKYVTNPRPASSIRLARVRVKLRRQDRTSALISVAASAAESHFSSAVVLPEPIGARATRTRRQA
    VSCGDGSSTGASRCRSRETPGQRLRTTAGRSQPYSIRASDTLEANAPPSSSAPPRRPPASAAMCGPRNAE
    AVSWRSWLIEVCGFALAALTLVLTLIFASLPEMGFPCFYATVADYDTLNDTSGGVWTRQPLVAPALFLET
    PTVTSFFGFTATVLLAHALYAVAGAVVLRREAGRLAFQPSVVLYAASTVAAPGTLMLGALCAWTLQAVVL
    LMAHKQAGLAAAAYITHFVFLALFGACHACKGTGDVRAALAASPPLRRVAVHARAVVTNVVLGAVGLGAA
    VVGLMLGVLLANSFHISLWKTAEAALAVFTLLALALMVFVEVVVSGYVQVLPTPAFCVLVASAAFGVSAH
    RYFAKFSEALGETHGVVIGTRAVLAVLSLIALAMIVVRLVRACIAHRARGSRFYANVDKARTTARRYLQK
    RLHGRGNDEYLLAPGSGDDEFDDGDEVVYENLGFE
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A glycoprotein M, gM, deletion in pseudorabies virus was attenuated and induced protection in piglets against intranasal challenge with 108 p.f.u. of the highly virulent PrV strain NIA-3 ((Dijkstra et al., 1997).
  • Related Vaccine(s): Psuedorabies virus glycoprotein M mutant vaccine
8. Gp50
  • Gene Name : Gp50
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • VO ID : VO_0011248
  • NCBI Protein GI : 2440155
  • Other Database IDs : CDD:174998
    InterPro: IPR002896
    UniProtKB/TrEMBL: O41201
  • Taxonomy ID : 10345
  • Gene Strand (Orientation) : ?
  • Protein Name : glycoprotein gp50
  • Protein Length : 237
  • Protein Note : isolated from camels
  • Protein Sequence : Show Sequence
    >gi|2440155|emb|CAA75105.1| glycoprotein gp50 [Suid herpesvirus 1]
    MLLAALLAALVARTTLGADVDAVPAPTLPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPPEDPCGVVA
    LISDPQVDRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQIFGRCRRRTTPMWWTPSAD
    YMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQHRTYKFGACWSDDS
    FNGGVDVMRFLTPFYQQPPHREVVNYW
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A NYVAC vaccinia vector containing genes for pseudorables virus glycoproteins gII and gp50 was administered to pigs to determine if it would have a greater protective effect than a vector containing the gene for gp50 alone. Both NYVAC vectors protected pigs similarly from virulent pseudorabies virus challenge (Brockmeier and Mengeling, 1996).
  • Related Vaccine(s): Pseudorabies recombinant vector vaccine encoding gp50 and gII protein , Pseudorabies recombinant vector vaccine encoding gp50 protein
9. gp50
  • Gene Name : gp50
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • NCBI Gene ID : 2952548
  • NCBI Protein GI : 51557533
  • Locus Tag : SuHV1_gp50
  • Genbank Accession : BK001744
  • Protein Accession : YP_068367
  • Taxonomy ID : 10345
  • Gene Starting Position : 83052
  • Gene Ending Position : 86540
  • Gene Strand (Orientation) : +
  • Protein pI : 9.08
  • Protein Weight : 46944.96
  • Protein Length : 470
  • DNA Sequence : Show Sequence
    >gi|51557483:83052-86540 Suid herpesvirus 1, complete genome
    CATGTTCGCCTACGTGAAGCCGATGGCGCACGGCCCGGACATGGCCTCCGTCTACCAGTCCACGGGGCGC
    GTGCGGCGGCTGCTGCGCGACGAGCTCTTCGTGTACGTGGACGGCTCCGGCGCGCGCGGCGAGCCCATCT
    TCACGCCCGTGCTGCTGAACCACGTCGTGGGCTCGGGCTGGCCGGCGCGCCTGTCGCAGGTGACGAACCT
    CGTGTGCGCGCAGTTCCAGCGCCGCTGCCGCCCGGCGTTCGCGGCGGCGCGCGGGATGCGCCTCTTCTCC
    CGCTTCAAGTTCAAGCACCTGTTCGAGCGCTGCACGCTGACGAGCGTCAACGACAGCCTCAACATCCTGC
    ACGCGCTGCTGGAGAACAACCGCCTGCGGGTGGCGCTCGAGGGCTGCGAGCCGCCGCTGACGGCGCGCGC
    CTTCTGCGACTTTCTGCGCGACGCGCGCCTGGACGCCTTCGCCAGCCAGCAGGTGCTGCGGCAGCTGCGC
    CCCCCGGACCGGCCGGTGGCGGCCGACATCGCGGACAGCGGCGAGGTGGCCACCTTCGTGGAGAAGTACC
    TCGTGGCCGACGTGCCCGAGGACGAGCTGCAGGAGCTGCTGCGCGCGCTCGCCAACCCCGTGACGCGGGA
    GCAGTTTGTGGGCCTGGCCGTGCTCGGCGCGTGCGCGCGCGTCCCCGAGGCGCTGCGCAGCGAGCGCGTC
    TTCGGGGCCGTGTACGGGCACTACGCCTCCGGGGCCGTGCCCGTGGTGGCCGACGGGCGGCTGGAGCTGG
    CGGCGCTGGCCCCCGACTTCAACGTGCCCGCGCGCTGGGCCCTCACGCGGCGCTGCGCGCGCGTCGCGGA
    GGCCGCCGGGCTCTTCGAGGGCGCCTCGCCGGAGGTGGACTCGGCCGCGGTCGCGGCGGCGGCGGCCGAC
    GCCGAGCTGGCGCCGCTGCTGCTCGAGGTGCTGCGGTGCCACGTGCTGGACGCGACGACGGCCGCGCGGC
    GCCCCGTGCGCGCGGCCCTGAGCGCGCTGGGGGCGGGCGGGGGCGCGGGCCCGCTGAGCCGCGGGCGCCA
    CGCCGCGCTCGTGTTCAAGGTGATGTGGGAGGAGGCCTTCGGCGTGCGCGTCGGCCGCAGCCGGCAGACG
    TTCCCGGGGCCCACGCGCGTGAAGAACCTGCGCAAGGCCGAGATCGCCGCGCTGCTGCGCGACGCCGGCC
    TGGACCCGCCCGCGGGCGCCACCCACCGGCAGCTGTACGCCCTGCTGATGGAACGCCGGGGGGACTTTGC
    GGGGGAGAGGTATAAACTGCGCCTGCCCGCCTGGAGCCGGCTCATGTACCTGACCCAGGGCGGCTTCGAC
    GCGCCGCTGGACGCCGCGCTCTCGCTCGTGCCCGCGGAGGCGTGGCCGCGCACCGAGGGGGCCGTGGACT
    TTGCGGCGCTATGACGGCCGCGGCGGGGGAGCGCGTGTGCGCGGCCGGGATCTACACGGCCTGGACGGAG
    CCCGGCGCGCCGGGCGAGCTCCACGCGCTGGCGCACCTGCTGTGCCGCGACGGGGCCGGCGCGTACGCGG
    CGCGCTTCGTCCACGTGACGGCGGCGCCGTGGACGGGCTCGGCGGCCGCGGTGGCCGCGGCGCTGCGCGA
    CGCGAGCGGCACGGGGGCGCTGGCGGACCCGGCGCTGTGGCGCGGCGCGCACGGCGCGGTCATGGCGGCC
    CTGCGCCGCGCCCTCCCGGCGCTGGCCTTCTACGAGCCGCTGCGCTTCGAGACGGACCCGGCCACGAACC
    TGGTCACGGCCGCGACGCCGGCGGGCGGCGGCGGCGAAGAGGAGACGACCGGGGAGGGCGGCGAGGAGGA
    CGAGGACGAGGCCGGCCCGCGCGCGGGCATCATCCACGTGGACGCCGACGTCGTCGTGGACCGCGACGCC
    GCGCGCGCGCACGCCACCGAGGCGTGGCTGCCGCACGCCCAGCTGCGCGCCATGGCCGGCTGCGCCGCGC
    TCTCCGTCGAGATCACGACGCGGCGGACCAGCTTCGCGCGCGCCTACGCGGAGGCCGGCGCGCCGCCGCT
    GAAACGCCGGGGCGAGATGAGCGACCCCTTTGACGTGCGCGAGACGGTGCTGCGGCCCGCGGGCCGGCGC
    GTGGCGGCGCGCGTGCTCGTCCCGCGCGGCTTCGACTGCCTGGTGGCCCACGGCGTGAGCAACGCGGCGC
    TGGTGGCGCTCTACCGCCGGTGGCACGCGGCCGCGTACGGCGCGGGCGACGCGACCCCGCCCGTCTTCGC
    CTTCCTGGGGCCCGAGCTCGCCCGCGAGGGCGCGGACGAGGACTACTACTGCGCGCTGGGCTTCCCCCTG
    TTTGCGACGATCAAGGTGGCCGCGGCCGCGCCGGAGGCGGTCCGCGGCGCGCTCGCCGCCCACCGGCTCA
    CGGACGGGCTGTGGCCCGCGCTCGGCTTCCGCGCCTTCCACGCCCTCGGGCCCGTGAGCTGCGGCCTGCG
    CCTGCGCTGCGACGTCTGGCCGGCGGGGCGCGCGACCAGCGCCGTGGAGCACCCGTGCGCCCTCCGCGGG
    GCCTGGCTGGCCAAGTTTGACTTCGCGGCCTTCTTCCCCAACCTGTTTCTGGCCCTGTGCCCGGGCCACG
    AGCGGCTGCGGCGCGCCGTGCGGGCGCGCGCGGTCAAGCCGGCGCTCGTGGCCTTCTTCGGCGGGCTCAA
    GCACACGTGCCCGGAGGCGTACCACAGCGTCATCGCGCTGGCCAACGGGGTCTCGCGCGCCGTCGAGGCG
    GCCGCGGCCGAGGCCGGCCTGGTCACGTGCGCCTACGTCAAGGACGGCTTCTGGGGCGTGCTCGGCGACG
    TGCCCGCGGCCGCGCCGGAGGCGGCCGCCGCCGCCGCGGCCGAGCGCGTGCGCGTCGCCTGCGAGGCCGC
    CGCGGCGCGGCACCTGGCCGACGCGGGGGCCGCCGCGACGGACGTGACGCTGCGCTGCGAGGGCGTCTTC
    GACGCGGCCCTGGCCTGGTCCTGCCACGCCTACTGGCTGCGGCGGCGCGAGGGCCCCGCGGACTTTGTCG
    GCTTCCCGTCGCGCAGCGGCTTCGGCCGCGCCGCCAAGGCCGCGCTGGACGCCCTGCTGCGCGAGGCCGT
    CGAGGGCCGCGCGGACGCCGAGGCCGCGCGCGCCGCCTGCGACGGCCTCGTCGAGCGGGCCTTCGCCTCG
    CGCCACGACCCCGACTTCTGGGCCGCGCCGGGGGACGCCCTCGCCCCCGCCGCGTGCGCAGGGGCGACCG
    CCGGGCGCGGCGGCGCGCGCTGCTCGCGGCGCTGCGTGCGCCTGCGCGGCGCCGGCCCGGTGCCCTACGA
    GCAGCTGCGCCCCCCGCTGATCCTGCCCTGGATAGACTGTCTGGCCCACATGGAGCCCATCTTCGCCGCC
    CTCGTCGGCATGTACAACCGCGCGCTCGAGGCGCTGAGCGCCGGCGACGCCCCGCCGCCATTTGTGTTTA
    CATACACGCCGGACGCGTTTCTGTTTGGGTAAACAATAAAGTCTGTTTATTGTCAGAAC
  • Protein Sequence : Show Sequence
    >gi|51557533|ref|YP_068367.1| UL8.5 protein [Suid herpesvirus 1]
    MFAYVKPMAHGPDMASVYQSTGRVRRLLRDELFVYVDGSGARGEPIFTPVLLNHVVGSGWPARLSQVTNL
    VCAQFQRRCRPAFAAARGMRLFSRFKFKHLFERCTLTSVNDSLNILHALLENNRLRVALEGCEPPLTARA
    FCDFLRDARLDAFASQQVLRQLRPPDRPVAADIADSGEVATFVEKYLVADVPEDELQELLRALANPVTRE
    QFVGLAVLGACARVPEALRSERVFGAVYGHYASGAVPVVADGRLELAALAPDFNVPARWALTRRCARVAE
    AAGLFEGASPEVDSAAVAAAAADAELAPLLLEVLRCHVLDATTAARRPVRAALSALGAGGGAGPLSRGRH
    AALVFKVMWEEAFGVRVGRSRQTFPGPTRVKNLRKAEIAALLRDAGLDPPAGATHRQLYALLMERRGDFA
    GERYKLRLPAWSRLMYLTQGGFDAPLDAALSLVPAEAWPRTEGAVDFAAL
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A gp50+gp63 deletion mutant in Pseudorabies virus was attenuated and provided protection from clinical signs of Aujeszky's disease after a challenge inoculation with the virulent wild-type PRV strain NIA-3 (Peeters et al., 1994).
  • Related Vaccine(s): NYVAC-PRV- gII/ gp50 , Pseudorabies virus gp50/gp63 mutant vaccine
10. gp63
  • Gene Name : gp63
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • NCBI Gene ID : 2952540
  • NCBI Protein GI : 51557548
  • Locus Tag : SuHV1_gp63
  • Genbank Accession : BK001744
  • Protein Accession : YP_068382
  • Taxonomy ID : 10345
  • Gene Starting Position : 102695
  • Gene Ending Position : 107803
  • Gene Strand (Orientation) : -
  • Protein Name : transcriptional regulator ICP4
  • Protein pI : 8.04
  • Protein Weight : 141692.15
  • Protein Length : 1446
  • DNA Sequence : Show Sequence
    >gi|51557483:102695-107803 Suid herpesvirus 1, complete genome
    CAGAAAATACAGCACAAACTTTATTTTCTCACTCTGAAAACAAACTCTTTTCTCACCCGATGGGAGAAGG
    AGGAGAAGGGGACCGGGGGACCGCGGGAGGAGGAGAAGGGGACCGGGACGATCCTCCGCCGCCGAGCCCT
    CCGCCGCGGCCGCCGCCGCCGCTTCCACCACCGCCGCCACCTCCGCCGCCGCCGCAGCCACCTCCGGCCG
    GGGGATCCGCGCGGAGGAGAAGGAGAGGAGGAGGGCCACCGGGCCGGGGAGGCAGGCGCCGGGGAGGCAA
    GCGCCGCCGGGCCGAGGGGACCGAGGCCGCCGCCGCGGACGCAGAGGAGGAGGAGGACGGGGACGGGGAC
    GAGGACGAGGACGAGGACCGGGCCGAGGGCGAGGGGAGAGAAGACGGAGGAGAAGGGCCTCGAGGAGCCG
    GTGGAGGGGCCGGAGAGTCAGAGTCAGAGTCCGGCCGGGCCGAGGGGGCGCCCCGCTCAGCGGAGCAGCA
    GGTAGGGGTTGCCGGCGTCCTCGGCCTCCTCGTCGTCCGAGATGGCCTCCACCTTGATGGGCCCGAGCGG
    GCCGCGGGGCCGGCCGTCGCCGCCGCGGACGCCGACGATCTCCACAGAGTCCCCGTCCTCGCCGGGGCCG
    GCCCCGGCGCCCGAGGCCCCCGCGGGCCGGTGGGTCTCCACGGCGCCCCCGGCGGCGGCGCGGACGCTGG
    TCTCGAAGGGGGCAAAGTCCCAGAGCACGGCCGGCGGGGCGCCCGCGGCGGCGACGGCGCCCGGGGTCAG
    CACCAGCGGGGCGGCCTCGGCGTCGGGCTCCAGCAGCGCCGCGGCGCAGAAGGCGCGCAACTCGGCCGGC
    AGGCCCTCGGGGCCGCGGAGCTCGGCGAGGCCCCGGCGGCCGCAGGAGACGAAGACGGGCCGCAGCGGGG
    CGCCGAGCCCCCAGCGGTTGGCCGCGCGGTGCCCGAAGGCGGCGCCCGCGTCAAAGTCCGGGTCCCCGAG
    CCCGAGCGCGGAGCGCTGGCGGGCCATGTCCTTGCAGCCGTCCACGGTGGGGAGCACGCGCTGGCGGTAG
    GCGCGCGGCGGCAGCGGGACCGGGGTCCGGGGCCCGGCGCGGGTGCTCACCGTGTAGCGCACGTTGTCCT
    GGCGGCAGAGGCGCAGCGGCTCGGCCCCGGGGTGCAGGCGGGCGAAGGAGGCCTCCACGCGGGCGAAGCA
    GGCCGGGCCCACGATGGAGCTAGAGTCCAGCACGGCCGCGCGGAGCTCGCGGCACCCGGGCCAGCGCACG
    GCGCACTGGGCGGCCGGGTCCAGGCGGACGCGGACGTAGACGTGGTAGTCCCCCACGGCCGGGCCGTCCG
    CGGGCCAGTCCTCGATGGTGTCCAGCACGATGAGCCGGCGCCGCGCCGCGCCGAGCCGCGAGCAGAGGTA
    CTCCACGGCGCCGGCGAAGCCGAGGTCCCGCGCCGAGAGCAGCAGCACCCCCTGGGCGTTGAGGCGGCCG
    ATGTCGGGGCGCCCGGTCCAGTTCCCGGCCCAGGCGTGCGAGTCCGGCGTGCAGAGGCGGTGGGCGAAGG
    CGGCGAGCAGCGCCGAGAGGCCGCCGCGGCGCGGGTCCCAGGCCGGGCGCGGGGCGCCCTCGGCGGGCTC
    GGCGCAGAGCTCCTCGTGGGGCAGCGGGTCGTAGAGCACCACCACGCGCACGTCCTCGGGGTCGGCTATC
    TGCCGCATCCAGGCGGCGCGGCGGCGGAGCGGGGCGCCGCGGCGCGCGGCGATGTGCGCCAGGGCGGCCG
    GGTCGAAGGTGAGCGCCGGGCGCCAGAGTTCGGGGAAGACCTCCTGGTCCACGAGGGCGCGGGCCACCTC
    GGGCGGGCAGTAGGCGGCGAGGGCCGCCTCGGAGGGCCGCGGCGTGTGGGTCTCGCCGGCCGGGACGCGG
    CGGAAGCCGCCGTCGGGCGCGGGGTGCTCGGGCATGGGCCCGAGCGGGCGCCGGAGCCGGTCGTCCTCGG
    AGGAGGAGGAGGAGGAGGACAGCAGCGCGGGAGCGGGGTCCGGAGCGGGCCCGAGTCCGAGGGAGCGGCG
    CTTGCGCCGGGGCCCCCGGTCCTCTTCGTCGTCGCGGTGGCCGTGGCCGTCCCCGCGGAGGGCCGCGCCG
    GAGAGCCCCTCGTCCTCCTCGCCGTCCCCGGGGCGGCGGGCCCCGGGCGCGCGGCGCTTCTTCTTGCGCC
    GCTCGGGCGCTGGGTCCGGGCCGGCGGCGGGGGAGCTGGCGTAGCCGGAGGAGCCGGAGAGGCCGGACTT
    GGTGCTGGAGCTGGACTTGGTGCTGGAGCTGGACTTGGTGCTGGCGGGGCTGGAGGGCCCGGAGCCGGGG
    AGGCCGGAGGGGGCGCCCGCCGCCGCCGGCGCCGGCGCTGGGACGACGAGGCCGGGCTGCTCGGGCCAGA
    GCGGGGGCAGGCCGGGCGCGGGCTCCGCGGGCCCGGGCCGCGCGGCGGCCTCGGCGAGCCGGGCCGCGGC
    CACGTTGGCCGGGGCGAAGAGGGCCGCGGCGTAGGTCCAGGCGGCCTCGCGGGCGCGGGCCCCGTCCACG
    CTGTAGCGCACCAGCGGCGCCACGGTGCGGGCGACGAGGGCGACAGAGTCCGCGGCCTGCCGCCGCTCGG
    CCGGGCCGGCCCCGGGGATCGCGTCGCGGAGCGCGAGCAGCGCGGCCGTCACCTCCTCGAGGCAGGCGGG
    CCCGAGGGCGGCCGGGGCGCGGGCGGGCGCGGGCAGCCGGAGCGGGCAGGGCAGCAGGCGCTCGAGGACG
    CCGCGGCAGGCCAGGACGCAGGCGTCCGCCAGCTCGCGGGGCACGCGGCCGGGCTGCGCGGCGGCGAAGG
    CGGCGCGGACGCGGGCGCAGAGGGCCTCGACGGTCGCCTCCCCGGCGCGGGGGTCCGCGGCGCGGCCCGG
    GTAGGCCATGTCGGCGTAGGCCCGGCGGAGGCTCTGCAGGATGAAGGTCTTCTGGGTGCGATCGTAGCGG
    CGGCTCATGGCCACGGCGCTCACCGCGTGCGGCAGGGCCCAGAGCGGGTCCTGGGCGGCCATGGCGTCCC
    CGATGTGCGGCAGCGGCGGGGTCACGCTGCCGGTGATGAAGGAGCCGTGGCCGTGGGGCGCGTGGACCCG
    GCGCTGGCAGAACTGGTTGAAGCGCTGGTCGGGGGCCTGCATCCGCGGGTTCTGCAGCCAGGACATGGCC
    TCGCCGGCGGCCCCGCTGTAGATGAGGCGCACGAGGGCCTCGTGCTGCTTCCTCGAGTCCCCCATCTCCG
    GGATGAAGACGGGCACGGGCCCGGCCGCGGCGCGGTAGCGGGCCGCGGCCTGGCGGACGTCGTCCTCGTC
    CCAGAGCCCCTCGCGGGAGTCCCCGGCGCCGCCGTAGCGGACGCGGCCGTCGGCCGGAGGGTCGGAGCCG
    GGCCAGGGCTCCCCGAGCGGGGTGAGCAGCGGCCCGTCGGTCGGCGGGGGCCCGTCGGCCATGAGCGAGA
    GGTGGTTGTTGGTGGAGCGGCGCTTCCTGCGCGGGGGCCGGGCGGGCTCCGGGGCCGGGGCCGGGGAGGC
    CGCGGCGGAGGAGGAGGCGGAGGAGGCCGAGGGCCGCGGGGCCGCGGCGGGCGCCGGCGGAGACGGTGGC
    GGCCCGGCGCGGGCGAGTGGGGCGCCGGGCCGGACTCCTTCGTCTTCTTCTCCCTCGGAGGAGGACGAGG
    ACGAGGAGGACGAGGAGGACGAGGAGGACGAGGACGAGGAGGAGGCCGAGCGCCGCGCGGCGGCGGCGGG
    GGCCCGGGGGGCGGAGGGCGAGCGGGCCGGGGAGAGGTCCGAGTCGCTGCCGCTGCTGCTGGAGCTGCTG
    AAGCCGCGGCCGCGGCGGAGGGCGCCCTCTCCGGCGCGGCGCCGGCGGGGCTGTCTCTGCGGGGGCGCCC
    CGCCGTCCCCGGCGAGGCCGAGTCCGTCCTCGTCCTTCTCGGGGCCGCGGGCGACGGTCTCGACGGCGAC
    GGTGGTGGTGGAGTTGGAGTTGGAGTTGGGGTTGGAGGAGACGGGGCTCCGGGCGCCAAGCGGCCGAGGA
    TCGAGCCGCCTCGCGGCGGCGGGCTCGTCGAGCAGGGGCTCGCGGTGCTGGTGATGGTGACGACCGCGGT
    CCCCTCCGGCGGAGGGGGCGCCGCCGCCGCCGGGCGCCGAGACCGGCCCGGCGGCGGGGGAGGCTGGGGA
    AGCGGGCCCCCGCCGTGCCGGCGCTGCGGCCACCGCTGCTGGCTGTGCTGGTGGCGCCGGGGTCCGAGGC
    CGCGCCGCCGGCCCGGGCTCACCGACCGGGTCCCCCCTCGCGGGGGACCATCTCCGCGGGGCTGCCGAGG
    GGCCGGGAGAGCCGGAGGAGGAGGCCGGGGAGGCTGCGGAGGGGGACGAGCGCCCGGGGCCGCCGGGGGC
    CCCGGCCTCTGCCGCTGCGAGTGCTGCCGGGGTCGGCGGCCGGGGCCCGGAGCCGGCCCGGGACCGGGGC
    CCGAGGACGAGGTGACCGTGCTCGGAGCCCTGATGGAGAGCCCGACCGGGGGACCCGGCGGCCGGGGACC
    CGGGCTCGTCCTCCTCCTCGTCTTCGTCGTCTAGCACCACGATCTCGCCCGAGCCCCGGCGGGGCTGCTG
    CTGCTGCTGGGCCGAAGGAGGACGGGGCGGCCTCGTGGCTCCGGCCGCGGCCGCGAGGACGGCGGCCTCG
    GCCTCGGCGGCGTCGTCGGAGAAGAGGCCGCCCGGGCCGAAGAGGAGATCCTCGCCGGAGGAGCCGCGGC
    GCCGGGAGCCCTGGCTGCCGCCGTCGGGGCCGGACGCGATGCCCTCTTCCTCGGCCGCGGCGGCGGCCGC
    CAGGAGCTGGCTGAAGTTGCCCTCGGTCTCGATGAAGTCAAAGAGATCGTCGGCCATGGTCTCGATCGGG
    GTCTTTCTGCCTGAGCGAGGCCGGGCGCCGAGCGCGGAGAGCGGGCGGCGGAGAAGAAGGAGGAAGGCGG
    CCGGAGGAGGAGAAGAAGAAGACTCTTCTCTGGCGGGCCGAGAGCCTCGGTGGGTCGGGCGTCCGTCGAG
    GGCTGATAGCCGCCGGAGAGCCGGAGTCTTCAGAGTCCGCGCCGGAGCGGAGACGGTCGGATCCCCTCGG
    GTTGGCAGAGAACGATGCTGTCCGTACCTGCACCGCAGTGAAGTGCTACGATGGAGACCGCGCTTATAA
  • Protein Sequence : Show Sequence
    >gi|51557548|ref|YP_068382.1| transcriptional regulator ICP4 [Suid herpesvirus 1]
    MADDLFDFIETEGNFSQLLAAAAAAEEEGIASGPDGGSQGSRRRGSSGEDLLFGPGGLFSDDAAEAEAAV
    LAAAAGATRPPRPPSAQQQQQPRRGSGEIVVLDDEDEEEDEPGSPAAGSPGRALHQGSEHGHLVLGPRSR
    AGSGPRPPTPAALAAAEAGAPGGPGRSSPSAASPASSSGSPGPSAAPRRWSPARGDPVGEPGPAARPRTP
    APPAQPAAVAAAPARRGPASPASPAAGPVSAPGGGGAPSAGGDRGRHHHQHREPLLDEPAAARRLDPRPL
    GARSPVSSNPNSNSNSTTTVAVETVARGPEKDEDGLGLAGDGGAPPQRQPRRRRAGEGALRRGRGFSSSS
    SSGSDSDLSPARSPSAPRAPAAAARRSASSSSSSSSSSSSSSSSSSSEGEEDEGVRPGAPLARAGPPPSP
    PAPAAAPRPSASSASSSAAASPAPAPEPARPPRRKRRSTNNHLSLMADGPPPTDGPLLTPLGEPWPGSDP
    PADGRVRYGGAGDSREGLWDEDDVRQAAARYRAAAGPVPVFIPEMGDSRKQHEALVRLIYSGAAGEAMSW
    LQNPRMQAPDQRFNQFCQRRVHAPHGHGSFITGSVTPPLPHIGDAMAAQDPLWALPHAVSAVAMSRRYDR
    TQKTFILQSLRRAYADMAYPGRAADPRAGEATVEALCARVRAAFAAAQPGRVPRELADACVLACRGVLER
    LLPCPLRLPAPARAPAALGPACLEEVTAALLALRDAIPGAGPAERRQAADSVALVARTVAPLVRYSVDGA
    RAREAAWTYAAALFAPANVAAARLAEAAARPGPAEPAPGLPPLWPEQPGLVVPAPAPAAAGAPSGLPGSG
    PSSPASTKSSSSTKSSSSTKSGLSGSSGYASSPAAGPDPAPERRKKKRRAPGARRPGDGEEDEGLSGAAL
    RGDGHGHRDDEEDRGPRRKRRSLGLGPAPDPAPALLSSSSSSSEDDRLRRPLGPMPEHPAPDGGFRRVPA
    GETHTPRPSEAALAAYCPPEVARALVDQEVFPELWRPALTFDPAALAHIAARRGAPLRRRAAWMRQIADP
    EDVRVVVLYDPLPHEELCAEPAEGAPRPAWDPRRGGLSALLAAFAHRLCTPDSHAWAGNWTGRPDIGRLN
    AQGVLLLSARDLGFAGAVEYLCSRLGAARRRLIVLDTIEDWPADGPAVGDYHVYVRVRLDPAAQCAVRWP
    GCRELRAAVLDSSSIVGPACFARVEASFARLHPGAEPLRLCRQDNVRYTVSTRAGPRTPVPLPPRAYRQR
    VLPTVDGCKDMARQRSALGLGDPDFDAGAAFGHRAANRWGLGAPLRPVFVSCGRRGLAELRGPEGLPAEL
    RAFCAAALLEPDAEAAPLVLTPGAVAAAGAPPAVLWDFAPFETSVRAAAGGAVETHRPAGASGAGAGPGE
    DGDSVEIVGVRGGDGRPRGPLGPIKVEAISDDEEAEDAGNPYLLLR
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A gp50+gp63 deletion mutant in Pseudorabies virus was attenuated and provided protection from clinical signs of Aujeszky's disease after a challenge inoculation with the virulent wild-type PRV strain NIA-3 (Peeters et al., 1994).
  • Related Vaccine(s): Pseudorabies virus gp50/gp63 mutant vaccine
11. IE180
  • Gene Name : IE180
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • VO ID : VO_0011242
  • NCBI Gene ID : 2952540
  • NCBI Protein GI : 51557548
  • Locus Tag : SuHV1_gp63
  • Genbank Accession : BK001744
  • Protein Accession : YP_068382
  • Taxonomy ID : 10345
  • Gene Starting Position : 102695
  • Gene Ending Position : 107803
  • Gene Strand (Orientation) : -
  • Protein Name : transcriptional regulator ICP4
  • Protein pI : 8.04
  • Protein Weight : 141692.15
  • Protein Length : 1446
  • Protein Note : transcriptional regulator ICP4; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA; transcriptional regulator ICP4 ( infected-cell polypeptide 4) is a sequence-specific transcriptional activator that is required for efficient transcription of early and late viral genes; ICP4 is essential for productive infection
  • DNA Sequence : Show Sequence
    >gi|51557483:102695-107803 Suid herpesvirus 1, complete genome
    CAGAAAATACAGCACAAACTTTATTTTCTCACTCTGAAAACAAACTCTTTTCTCACCCGATGGGAGAAGG
    AGGAGAAGGGGACCGGGGGACCGCGGGAGGAGGAGAAGGGGACCGGGACGATCCTCCGCCGCCGAGCCCT
    CCGCCGCGGCCGCCGCCGCCGCTTCCACCACCGCCGCCACCTCCGCCGCCGCCGCAGCCACCTCCGGCCG
    GGGGATCCGCGCGGAGGAGAAGGAGAGGAGGAGGGCCACCGGGCCGGGGAGGCAGGCGCCGGGGAGGCAA
    GCGCCGCCGGGCCGAGGGGACCGAGGCCGCCGCCGCGGACGCAGAGGAGGAGGAGGACGGGGACGGGGAC
    GAGGACGAGGACGAGGACCGGGCCGAGGGCGAGGGGAGAGAAGACGGAGGAGAAGGGCCTCGAGGAGCCG
    GTGGAGGGGCCGGAGAGTCAGAGTCAGAGTCCGGCCGGGCCGAGGGGGCGCCCCGCTCAGCGGAGCAGCA
    GGTAGGGGTTGCCGGCGTCCTCGGCCTCCTCGTCGTCCGAGATGGCCTCCACCTTGATGGGCCCGAGCGG
    GCCGCGGGGCCGGCCGTCGCCGCCGCGGACGCCGACGATCTCCACAGAGTCCCCGTCCTCGCCGGGGCCG
    GCCCCGGCGCCCGAGGCCCCCGCGGGCCGGTGGGTCTCCACGGCGCCCCCGGCGGCGGCGCGGACGCTGG
    TCTCGAAGGGGGCAAAGTCCCAGAGCACGGCCGGCGGGGCGCCCGCGGCGGCGACGGCGCCCGGGGTCAG
    CACCAGCGGGGCGGCCTCGGCGTCGGGCTCCAGCAGCGCCGCGGCGCAGAAGGCGCGCAACTCGGCCGGC
    AGGCCCTCGGGGCCGCGGAGCTCGGCGAGGCCCCGGCGGCCGCAGGAGACGAAGACGGGCCGCAGCGGGG
    CGCCGAGCCCCCAGCGGTTGGCCGCGCGGTGCCCGAAGGCGGCGCCCGCGTCAAAGTCCGGGTCCCCGAG
    CCCGAGCGCGGAGCGCTGGCGGGCCATGTCCTTGCAGCCGTCCACGGTGGGGAGCACGCGCTGGCGGTAG
    GCGCGCGGCGGCAGCGGGACCGGGGTCCGGGGCCCGGCGCGGGTGCTCACCGTGTAGCGCACGTTGTCCT
    GGCGGCAGAGGCGCAGCGGCTCGGCCCCGGGGTGCAGGCGGGCGAAGGAGGCCTCCACGCGGGCGAAGCA
    GGCCGGGCCCACGATGGAGCTAGAGTCCAGCACGGCCGCGCGGAGCTCGCGGCACCCGGGCCAGCGCACG
    GCGCACTGGGCGGCCGGGTCCAGGCGGACGCGGACGTAGACGTGGTAGTCCCCCACGGCCGGGCCGTCCG
    CGGGCCAGTCCTCGATGGTGTCCAGCACGATGAGCCGGCGCCGCGCCGCGCCGAGCCGCGAGCAGAGGTA
    CTCCACGGCGCCGGCGAAGCCGAGGTCCCGCGCCGAGAGCAGCAGCACCCCCTGGGCGTTGAGGCGGCCG
    ATGTCGGGGCGCCCGGTCCAGTTCCCGGCCCAGGCGTGCGAGTCCGGCGTGCAGAGGCGGTGGGCGAAGG
    CGGCGAGCAGCGCCGAGAGGCCGCCGCGGCGCGGGTCCCAGGCCGGGCGCGGGGCGCCCTCGGCGGGCTC
    GGCGCAGAGCTCCTCGTGGGGCAGCGGGTCGTAGAGCACCACCACGCGCACGTCCTCGGGGTCGGCTATC
    TGCCGCATCCAGGCGGCGCGGCGGCGGAGCGGGGCGCCGCGGCGCGCGGCGATGTGCGCCAGGGCGGCCG
    GGTCGAAGGTGAGCGCCGGGCGCCAGAGTTCGGGGAAGACCTCCTGGTCCACGAGGGCGCGGGCCACCTC
    GGGCGGGCAGTAGGCGGCGAGGGCCGCCTCGGAGGGCCGCGGCGTGTGGGTCTCGCCGGCCGGGACGCGG
    CGGAAGCCGCCGTCGGGCGCGGGGTGCTCGGGCATGGGCCCGAGCGGGCGCCGGAGCCGGTCGTCCTCGG
    AGGAGGAGGAGGAGGAGGACAGCAGCGCGGGAGCGGGGTCCGGAGCGGGCCCGAGTCCGAGGGAGCGGCG
    CTTGCGCCGGGGCCCCCGGTCCTCTTCGTCGTCGCGGTGGCCGTGGCCGTCCCCGCGGAGGGCCGCGCCG
    GAGAGCCCCTCGTCCTCCTCGCCGTCCCCGGGGCGGCGGGCCCCGGGCGCGCGGCGCTTCTTCTTGCGCC
    GCTCGGGCGCTGGGTCCGGGCCGGCGGCGGGGGAGCTGGCGTAGCCGGAGGAGCCGGAGAGGCCGGACTT
    GGTGCTGGAGCTGGACTTGGTGCTGGAGCTGGACTTGGTGCTGGCGGGGCTGGAGGGCCCGGAGCCGGGG
    AGGCCGGAGGGGGCGCCCGCCGCCGCCGGCGCCGGCGCTGGGACGACGAGGCCGGGCTGCTCGGGCCAGA
    GCGGGGGCAGGCCGGGCGCGGGCTCCGCGGGCCCGGGCCGCGCGGCGGCCTCGGCGAGCCGGGCCGCGGC
    CACGTTGGCCGGGGCGAAGAGGGCCGCGGCGTAGGTCCAGGCGGCCTCGCGGGCGCGGGCCCCGTCCACG
    CTGTAGCGCACCAGCGGCGCCACGGTGCGGGCGACGAGGGCGACAGAGTCCGCGGCCTGCCGCCGCTCGG
    CCGGGCCGGCCCCGGGGATCGCGTCGCGGAGCGCGAGCAGCGCGGCCGTCACCTCCTCGAGGCAGGCGGG
    CCCGAGGGCGGCCGGGGCGCGGGCGGGCGCGGGCAGCCGGAGCGGGCAGGGCAGCAGGCGCTCGAGGACG
    CCGCGGCAGGCCAGGACGCAGGCGTCCGCCAGCTCGCGGGGCACGCGGCCGGGCTGCGCGGCGGCGAAGG
    CGGCGCGGACGCGGGCGCAGAGGGCCTCGACGGTCGCCTCCCCGGCGCGGGGGTCCGCGGCGCGGCCCGG
    GTAGGCCATGTCGGCGTAGGCCCGGCGGAGGCTCTGCAGGATGAAGGTCTTCTGGGTGCGATCGTAGCGG
    CGGCTCATGGCCACGGCGCTCACCGCGTGCGGCAGGGCCCAGAGCGGGTCCTGGGCGGCCATGGCGTCCC
    CGATGTGCGGCAGCGGCGGGGTCACGCTGCCGGTGATGAAGGAGCCGTGGCCGTGGGGCGCGTGGACCCG
    GCGCTGGCAGAACTGGTTGAAGCGCTGGTCGGGGGCCTGCATCCGCGGGTTCTGCAGCCAGGACATGGCC
    TCGCCGGCGGCCCCGCTGTAGATGAGGCGCACGAGGGCCTCGTGCTGCTTCCTCGAGTCCCCCATCTCCG
    GGATGAAGACGGGCACGGGCCCGGCCGCGGCGCGGTAGCGGGCCGCGGCCTGGCGGACGTCGTCCTCGTC
    CCAGAGCCCCTCGCGGGAGTCCCCGGCGCCGCCGTAGCGGACGCGGCCGTCGGCCGGAGGGTCGGAGCCG
    GGCCAGGGCTCCCCGAGCGGGGTGAGCAGCGGCCCGTCGGTCGGCGGGGGCCCGTCGGCCATGAGCGAGA
    GGTGGTTGTTGGTGGAGCGGCGCTTCCTGCGCGGGGGCCGGGCGGGCTCCGGGGCCGGGGCCGGGGAGGC
    CGCGGCGGAGGAGGAGGCGGAGGAGGCCGAGGGCCGCGGGGCCGCGGCGGGCGCCGGCGGAGACGGTGGC
    GGCCCGGCGCGGGCGAGTGGGGCGCCGGGCCGGACTCCTTCGTCTTCTTCTCCCTCGGAGGAGGACGAGG
    ACGAGGAGGACGAGGAGGACGAGGAGGACGAGGACGAGGAGGAGGCCGAGCGCCGCGCGGCGGCGGCGGG
    GGCCCGGGGGGCGGAGGGCGAGCGGGCCGGGGAGAGGTCCGAGTCGCTGCCGCTGCTGCTGGAGCTGCTG
    AAGCCGCGGCCGCGGCGGAGGGCGCCCTCTCCGGCGCGGCGCCGGCGGGGCTGTCTCTGCGGGGGCGCCC
    CGCCGTCCCCGGCGAGGCCGAGTCCGTCCTCGTCCTTCTCGGGGCCGCGGGCGACGGTCTCGACGGCGAC
    GGTGGTGGTGGAGTTGGAGTTGGAGTTGGGGTTGGAGGAGACGGGGCTCCGGGCGCCAAGCGGCCGAGGA
    TCGAGCCGCCTCGCGGCGGCGGGCTCGTCGAGCAGGGGCTCGCGGTGCTGGTGATGGTGACGACCGCGGT
    CCCCTCCGGCGGAGGGGGCGCCGCCGCCGCCGGGCGCCGAGACCGGCCCGGCGGCGGGGGAGGCTGGGGA
    AGCGGGCCCCCGCCGTGCCGGCGCTGCGGCCACCGCTGCTGGCTGTGCTGGTGGCGCCGGGGTCCGAGGC
    CGCGCCGCCGGCCCGGGCTCACCGACCGGGTCCCCCCTCGCGGGGGACCATCTCCGCGGGGCTGCCGAGG
    GGCCGGGAGAGCCGGAGGAGGAGGCCGGGGAGGCTGCGGAGGGGGACGAGCGCCCGGGGCCGCCGGGGGC
    CCCGGCCTCTGCCGCTGCGAGTGCTGCCGGGGTCGGCGGCCGGGGCCCGGAGCCGGCCCGGGACCGGGGC
    CCGAGGACGAGGTGACCGTGCTCGGAGCCCTGATGGAGAGCCCGACCGGGGGACCCGGCGGCCGGGGACC
    CGGGCTCGTCCTCCTCCTCGTCTTCGTCGTCTAGCACCACGATCTCGCCCGAGCCCCGGCGGGGCTGCTG
    CTGCTGCTGGGCCGAAGGAGGACGGGGCGGCCTCGTGGCTCCGGCCGCGGCCGCGAGGACGGCGGCCTCG
    GCCTCGGCGGCGTCGTCGGAGAAGAGGCCGCCCGGGCCGAAGAGGAGATCCTCGCCGGAGGAGCCGCGGC
    GCCGGGAGCCCTGGCTGCCGCCGTCGGGGCCGGACGCGATGCCCTCTTCCTCGGCCGCGGCGGCGGCCGC
    CAGGAGCTGGCTGAAGTTGCCCTCGGTCTCGATGAAGTCAAAGAGATCGTCGGCCATGGTCTCGATCGGG
    GTCTTTCTGCCTGAGCGAGGCCGGGCGCCGAGCGCGGAGAGCGGGCGGCGGAGAAGAAGGAGGAAGGCGG
    CCGGAGGAGGAGAAGAAGAAGACTCTTCTCTGGCGGGCCGAGAGCCTCGGTGGGTCGGGCGTCCGTCGAG
    GGCTGATAGCCGCCGGAGAGCCGGAGTCTTCAGAGTCCGCGCCGGAGCGGAGACGGTCGGATCCCCTCGG
    GTTGGCAGAGAACGATGCTGTCCGTACCTGCACCGCAGTGAAGTGCTACGATGGAGACCGCGCTTATAA
  • Protein Sequence : Show Sequence
    >gi|51557548|ref|YP_068382.1| transcriptional regulator ICP4 [Suid herpesvirus 1]
    MADDLFDFIETEGNFSQLLAAAAAAEEEGIASGPDGGSQGSRRRGSSGEDLLFGPGGLFSDDAAEAEAAV
    LAAAAGATRPPRPPSAQQQQQPRRGSGEIVVLDDEDEEEDEPGSPAAGSPGRALHQGSEHGHLVLGPRSR
    AGSGPRPPTPAALAAAEAGAPGGPGRSSPSAASPASSSGSPGPSAAPRRWSPARGDPVGEPGPAARPRTP
    APPAQPAAVAAAPARRGPASPASPAAGPVSAPGGGGAPSAGGDRGRHHHQHREPLLDEPAAARRLDPRPL
    GARSPVSSNPNSNSNSTTTVAVETVARGPEKDEDGLGLAGDGGAPPQRQPRRRRAGEGALRRGRGFSSSS
    SSGSDSDLSPARSPSAPRAPAAAARRSASSSSSSSSSSSSSSSSSSSEGEEDEGVRPGAPLARAGPPPSP
    PAPAAAPRPSASSASSSAAASPAPAPEPARPPRRKRRSTNNHLSLMADGPPPTDGPLLTPLGEPWPGSDP
    PADGRVRYGGAGDSREGLWDEDDVRQAAARYRAAAGPVPVFIPEMGDSRKQHEALVRLIYSGAAGEAMSW
    LQNPRMQAPDQRFNQFCQRRVHAPHGHGSFITGSVTPPLPHIGDAMAAQDPLWALPHAVSAVAMSRRYDR
    TQKTFILQSLRRAYADMAYPGRAADPRAGEATVEALCARVRAAFAAAQPGRVPRELADACVLACRGVLER
    LLPCPLRLPAPARAPAALGPACLEEVTAALLALRDAIPGAGPAERRQAADSVALVARTVAPLVRYSVDGA
    RAREAAWTYAAALFAPANVAAARLAEAAARPGPAEPAPGLPPLWPEQPGLVVPAPAPAAAGAPSGLPGSG
    PSSPASTKSSSSTKSSSSTKSGLSGSSGYASSPAAGPDPAPERRKKKRRAPGARRPGDGEEDEGLSGAAL
    RGDGHGHRDDEEDRGPRRKRRSLGLGPAPDPAPALLSSSSSSSEDDRLRRPLGPMPEHPAPDGGFRRVPA
    GETHTPRPSEAALAAYCPPEVARALVDQEVFPELWRPALTFDPAALAHIAARRGAPLRRRAAWMRQIADP
    EDVRVVVLYDPLPHEELCAEPAEGAPRPAWDPRRGGLSALLAAFAHRLCTPDSHAWAGNWTGRPDIGRLN
    AQGVLLLSARDLGFAGAVEYLCSRLGAARRRLIVLDTIEDWPADGPAVGDYHVYVRVRLDPAAQCAVRWP
    GCRELRAAVLDSSSIVGPACFARVEASFARLHPGAEPLRLCRQDNVRYTVSTRAGPRTPVPLPPRAYRQR
    VLPTVDGCKDMARQRSALGLGDPDFDAGAAFGHRAANRWGLGAPLRPVFVSCGRRGLAELRGPEGLPAEL
    RAFCAAALLEPDAEAAPLVLTPGAVAAAGAPPAVLWDFAPFETSVRAAAGGAVETHRPAGASGAGAGPGE
    DGDSVEIVGVRGGDGRPRGPLGPIKVEAISDDEEAEDAGNPYLLLR
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : To examine the response by IE180 more closely, a vaccine trial in mice with a vector DNA construct that contains the gene encoding for IE180, designated pcDNAIE180 was conducted. Seven months after immunization with pcDNAIE180, an overall 25% of BALB/c, C3H/HeJ, and C57BL/6 mice receiving a lethal PrV challenge were protected (Chang et al., 1998).
  • Related Vaccine(s): Psuedorabies DNA vaccine encoding IE180 protein
12. UL23
  • Gene Name : UL23
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • NCBI Gene ID : 2952559
  • NCBI Protein GI : 51557518
  • Locus Tag : SuHV1_gp35
  • Genbank Accession : BK001744
  • Protein Accession : YP_068352
  • Taxonomy ID : 10345
  • Gene Starting Position : 59511
  • Gene Ending Position : 60589
  • Gene Strand (Orientation) : +
  • Protein Name : thymidine kinase
  • Protein pI : 7.14
  • Protein Weight : 32400.33
  • Protein Length : 320
  • Protein Note : 2.7.1.21
  • DNA Sequence : Show Sequence
    >gi|51557483:59511-60589 Suid herpesvirus 1, complete genome
    GATGCGCATCCTCCGGATCTACCTCGACGGCGCCTACGGCACCGGCAAGAGCACCACTGCCCGGGTGATG
    GCGCTCGGCGGGGCGCTGTACGTGCCCGAGCCGATGGCGTACTGGCGCACTCTGTTCGACACGGACACGG
    TGGCCGGTATTTACGATGCGCAGACCCGGAAGCAGAACGGCAGCCTGAGCGAGGAGGACGCGGCCCTCGT
    CACGGCGCAGCACCAGGCCGCCTTCGCGACGCCGTACCTGCTGCTGCACACGCGCCTGGTCCCGCTCTTC
    GGGCCCGCGGTCGAGGGCCCGCCCGAGATGACGGTCGTCTTTGACCGCCACCCGGTGGCCGCGACGGTGT
    GCTTCCCGCTGGCGCGCTTCATCGTCGGGGACATCAGCGCGGCGGCCTTCGTGGGCCTGGCGGCCACGCT
    GCCCGGGGAGCCCCCCGGCGGCAACCTGGTGGTGGCCTCGCTGGACCCGGACGAGCACCTGCGGCGCCTG
    CGCGCCCGCGCGCGCGCCGGGGAGCACGTGGACGCGCGCCTGCTCACGGCCCTGCGCAACGTCTACGCCA
    TGCTGGTCAACACGTCGCGCTACCTGAGCTCGGGGCGCCGCTGGCGCGACGACTGGGGGCGCGCGCCGCG
    CTTCGACCAGACCACGCGGGACTGCCTCGCGCTCAACGAGCTCTGCCGCCCGCGCGACGACCCCGAGCTC
    CAGGACACCCTCTTTGGCGCGTACAAGGCGCCCGAGCTCTGCGACCGGCGCGGGCGCCCGCTCGAGGTGC
    ACGCGTGGGCGATGGACGCGCTCGTGGCCAAGCTGCTGCCGCTGCGCGTCTCCACCGTCGACCTGGGGCC
    CTCGCCGCGCGTCTGCGCCGCGGCCGTGGCGGCGCAGACGCGCGGCATGGAGGTGACGGAGTCCGCGTAC
    GGCGACCACATCCGGCAGTGCGTGTGCGCCTTCACGTCGGAGATGGGGGTGTGACCCTCGCCCCTCCCAC
    CCGCGCCGCGGCCAGATGGAGACCGCGACGGAGGCAACGACGACGGCGTGGGAGGGGGCTCGGGGCGCGT
    ATAAAGCTATGTGTATGTCATCCCAATAA
  • Protein Sequence : Show Sequence
    >gi|51557518|ref|YP_068352.1| thymidine kinase [Suid herpesvirus 1]
    MRILRIYLDGAYGTGKSTTARVMALGGALYVPEPMAYWRTLFDTDTVAGIYDAQTRKQNGSLSEEDAALV
    TAQHQAAFATPYLLLHTRLVPLFGPAVEGPPEMTVVFDRHPVAATVCFPLARFIVGDISAAAFVGLAATL
    PGEPPGGNLVVASLDPDEHLRRLRARARAGEHVDARLLTALRNVYAMLVNTSRYLSSGRRWRDDWGRAPR
    FDQTTRDCLALNELCRPRDDPELQDTLFGAYKAPELCDRRGRPLEVHAWAMDALVAKLLPLRVSTVDLGP
    SPRVCAAAVAAQTRGMEVTESAYGDHIRQCVCAFTSEMGV
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A UL23 mutant, in combination with mutations in glycoproteins G and E, is attenuated in raccoons, with a 75% survival rate. This mutant also provides some protection from wild type PRV (Weigel et al., 2003).
  • Related Vaccine(s): Pseudorabies virus glycoprotein E/G/UL23 mutant vaccine
13. UL44
  • Gene Name : UL44
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • VO ID : VO_0011239
  • NCBI Gene ID : 2952505
  • NCBI Protein GI : 51557513
  • Locus Tag : SuHV1_gp30
  • Genbank Accession : BK001744
  • Protein Accession : YP_068347
  • Taxonomy ID : 10345
  • Gene Starting Position : 53985
  • Gene Ending Position : 55504
  • Gene Strand (Orientation) : +
  • Protein Name : envelope glycoprotein C
  • Protein pI : 6.98
  • Protein Weight : 45878.36
  • Protein Length : 479
  • Protein Note : envelope glycoprotein C; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA;virion envelope glycoproteins bind to cellular receptors; the nonessential glycoprotein gC interacts with cell surface proteoglycans, whereas the essential glycoprotein gD is involved in stable secondary attachment
  • DNA Sequence : Show Sequence
    >gi|51557483:53985-55504 Suid herpesvirus 1, complete genome
    TTTTAAAACCGCGATGGGGGGACGGGGGGCCATTCGCACGCGCCATGGCCTCGCTCGCGCGTGCGATGCT
    CGCTCTGCTGGCGCTCTACGCGGCGGCCATCGCCGCGGCGCCGTCGACCACGACGGCGCTCGACACGACG
    CCCAACGGGGGCGGCGGCGGCAACAGCAGCGAGGGAGAACTCTCGCCCTCTCCGCCCCCGACCCCCGCGC
    CCGCCTCGCCCGAGGCGGGCGCGGTCTCGACGCCCCCGGTCCCGCCGCCCTCGGTCTCGCGCAGGAAGCC
    CCCGCGGAACAACAACCGGACGCGCGTCCACGGCGACAAGGCCACCGCGCACGGGCGCAAGCGCATCGTG
    TGCCGGGAGCGGCTGTTCTCGGCGCGGGTGGGGGACGCGGTCAGCTTCGGGTGCGCCGTCTTCCCGCGCG
    CCGGGGAGACCTTCGAGGTCCGCTTCTACCGCCGCGGGCGCTTCCGCTCGCCCGACGCCGACCCCGAGTA
    CTTTGACGAGCCCCCGCGCCCGGAGCTCCCGCGGGAGCGGCTCCTCTTCAGCTCCGCCAACGCCTCCCTC
    GCCCACGCGGACGCGCTCGCGCCCGTCGTCGTCGAGGGCGAGCGCGCGACCGTCGCCAACGTCTCGGGCG
    AGGTGTCCGTGCGCGTGGCCGCGGCGGACGCCGAGACCGAGGGCGTCTACACGTGGCGCGTGCTGTCCGC
    CAACGGCACCGAGGTCCGGAGCGCCAACGTCTCGCTCCTCCTGTACAGCCAGCCCGAGTTCGGCCTGAGC
    GCGCCGCCCGTCCTCTTCGGTGAGCCCTTCCGGGCGGTGTGCGTCGTCCGCGACTACTACCCGCGGCGCA
    GCGTGCGCCTGCGCTGGTTCGCGGACGAGCACCCGGTGGACGCCGCCTTCGTGACCAACAGCACCGTGGC
    CGACGAGCTCGGGCGCCGCACGCGCGTCTCCGTGGTGAACGTGACGCGCGCGGACGTCCCGGGCCTCGCG
    GCCGCGGACGCCGCGGACGCGCTCGCGCCGAGCCTGCGCTGCGAGGCCGTGTGGTACCGCGACAGCGTGG
    CCTCGCAGCGCTTCTCCGAGGCCCTGCGCCCCCACGTCTACCACCCGGCGGCGGTCTCGGTGCGCTTCGT
    CGAGGGCTTCGCCGTCTGCGACGGCCTCTGCGTGCCCCCGGAGGCGCGCCTCGCCTGGTCCGACCACGCC
    GCCGACACCGTCTACCACCTCGGCGCCTGCGCGGAGCACCCCGGCCTGCTCAACGTGCGGAGCGCCCGCC
    CGCTGTCGGACCTCGACGGGCCCGTCGACTACACCTGCCGCCTCGAGGGCCTGCCCTCGCAGCTGCCCGT
    CTTCGAGGACACGCAGCGCTACGACGCCTCCCCCGCGTCCGTGAGCTGGCCCGTCGTGAGCAGCATGATC
    GTCGTCATCGCCGGCATCGGGATCCTGGCCATCGTGCTGGTCATCATGGCGACGTGCGTCTACTACCGCC
    GGGCGGGGCCGTGACGCCCCGCGCGTTCCCCCCCCACGTCGAATCAATAA
  • Protein Sequence : Show Sequence
    >gi|51557513|ref|YP_068347.1| envelope glycoprotein C [Suid herpesvirus 1]
    MASLARAMLALLALYAAAIAAAPSTTTALDTTPNGGGGGNSSEGELSPSPPPTPAPASPEAGAVSTPPVP
    PPSVSRRKPPRNNNRTRVHGDKATAHGRKRIVCRERLFSARVGDAVSFGCAVFPRAGETFEVRFYRRGRF
    RSPDADPEYFDEPPRPELPRERLLFSSANASLAHADALAPVVVEGERATVANVSGEVSVRVAAADAETEG
    VYTWRVLSANGTEVRSANVSLLLYSQPEFGLSAPPVLFGEPFRAVCVVRDYYPRRSVRLRWFADEHPVDA
    AFVTNSTVADELGRRTRVSVVNVTRADVPGLAAADAADALAPSLRCEAVWYRDSVASQRFSEALRPHVYH
    PAAVSVRFVEGFAVCDGLCVPPEARLAWSDHAADTVYHLGACAEHPGLLNVRSARPLSDLDGPVDYTCRL
    EGLPSQLPVFEDTQRYDASPASVSWPVVSSMIVVIAGIGILAIVLVIMATCVYYRRAGP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A trial vaccine containing pseudorabies virus (PRV) glycoprotein gC as the main component showed excellent protection against virulent virus infection in pigs (Katayama et al., 1997).
  • Related Vaccine(s): Pseduorabies Subunit Glycoprotein C Vaccine
14. UL50
  • Gene Name : UL50
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • NCBI Gene ID : 2952537
  • NCBI Protein GI : 51557490
  • Locus Tag : SuHV1_gp07
  • Genbank Accession : BK001744
  • Protein Accession : YP_068324
  • Taxonomy ID : 10345
  • Gene Starting Position : 8442
  • Gene Ending Position : 9457
  • Gene Strand (Orientation) : -
  • Protein Name : deoxyuridine triphosphatase
  • Protein pI : 9.02
  • Protein Weight : 26335.82
  • Protein Length : 268
  • Protein Note : 3.6.1.23
  • DNA Sequence : Show Sequence
    >gi|51557483:8442-9457 Suid herpesvirus 1, complete genome
    CTTTATTGAAAAATGAGAAGAGCGGGCCCCGCGTGTGTGCGCGCGCGGTCGCCACCGTCCGGGTCCGGCG
    CGGGCCGCCGCGGCCTCACAGGCCCGTGGAGCCGAAGCCGCGGGCCCCGCGCGCGCTGCTCGGGGCGACA
    AAGTCCCGCGCGAAGAGCCACGCGGGGCGGTGCTGCATCGGGGCGCGCGGGGTGGCGGGGAACGGGGACC
    GTCCCGTGATCCAGCCCAGCGGCTCGCGCGTCAGCACCAGCTGGGCCACGCGCTGGCCCGACTCCAGGGT
    CACCGGGTGCGCGCCGCGGTTCTGGATCCGGAAGCGGCACGGGCCGCTCTCCCAGGGCGTGGGGAAGACG
    ACGATGCCGCGGAGGTTGAGGGACGAGCGCCCGAAGACGTAGGCCCAGTGGCGGCCGTCCGTGCGGTGCA
    CCGGTAGCGTCACGGTCTCGGCGCCCCCGGGGGGCAGCACCAGCTCGCGCGGGCAGGGGATGTCGTATCC
    GGCGTCCTCGTCGCGCTTCGGCGCAAAGACCTCGAAGAAGGGCACGTCCGTGGCGATGCCCGGCGCGAGG
    CGCAGCGGCGTGCAATAAAATTGCGCCCGTGGGCGGCCCGGGGCTACAATCGCCTGCACCTCGCCGCGAA
    AGCCCGCGTCCACGATCCCGTTGGTGGTGCGACCGCCCCCGCGCTGCGCGACGAGCATCGCGTATCCGGT
    GGGCAGCGCCACCTTGAGGCCCAGGGGAACCTTATAAAATCCCTCCGGCCCCGGACTCCGGCACACCAGC
    AGCCGCCCTCCGTCCACGGTCACGGGCTCGCTCGCACACACCAGGATGGTCTCCTCCGCCGGGCTCTCGC
    TGACGCTCGTCGCCGCGCTCTGCGCGCTGGTGGCCCCCGCGCTCTCTTCCATCGTCTCCACCGAGGGGCC
    GCTGCCGCTGCTGCGCGAGGAGTCGCGGATCAACTTCTGGAACGCCGCCTGCGCCGCCAGGGGAGTCCCG
    GTGGATCAGCCCACGGCCGCCGCCGTGACATTTTAT
  • Protein Sequence : Show Sequence
    >gi|51557490|ref|YP_068324.1| deoxyuridine triphosphatase [Suid herpesvirus 1]
    MEESAGATSAQSAATSVSESPAEETILVCASEPVTVDGGRLLVCRSPGPEGFYKVPLGLKVALPTGYAML
    VAQRGGGRTTNGIVDAGFRGEVQAIVAPGRPRAQFYCTPLRLAPGIATDVPFFEVFAPKRDEDAGYDIPC
    PRELVLPPGGAETVTLPVHRTDGRHWAYVFGRSSLNLRGIVVFPTPWESGPCRFRIQNRGAHPVTLESGQ
    RVAQLVLTREPLGWITGRSPFPATPRAPMQHRPAWLFARDFVAPSSARGARGFGSTGL
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A UL50 mutant is attenuated in pseudorabies virus and induces significant protection in pigs from challenge with the highly virulent NIA-3 strain of PrV (Jöns et al., 1997).
  • Related Vaccine(s): Pseudorabies virus UL50 mutant vaccine
15. US3
  • Gene Name : US3
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • NCBI Gene ID : 2952561
  • NCBI Protein GI : 126802155
  • Locus Tag : SuHV1_gp65
  • Genbank Accession : BK001744
  • Protein Accession : YP_068384
  • Taxonomy ID : 10345
  • Gene Starting Position : 118238
  • Gene Ending Position : 120955
  • Gene Strand (Orientation) : +
  • Protein Name : serine/threonine protein kinase US3
  • Protein pI : 4.59
  • Protein Weight : 34398.44
  • Protein Length : 334
  • Protein Note : PK family
  • DNA Sequence : Show Sequence
    >gi|51557483:118238-120955 Suid herpesvirus 1, complete genome
    AAATAAAGGAGTCCGGGGAATTTGTTCCTTATACCTTGCCGGGCTCAGCAGGGGGTTGTCGCGCGTCCAC
    GCCCAGCGCTCGCACGCAGCAACAATGGCCGACGCCGGAATCCCCGACGAGATCCTGTACTCGGACATCA
    GCGACGACGAGATCATCATCGACGGCGACGGCGACAGCAGCGGGGACGAGGACGACGATGACGGGGGGCT
    GACGCGGCAGGCCGCGGCGCGCATCGTCACGGACCTGGGCTTCGAGGTGCTGCAGCCCCTGCAGTCGGGC
    TCGGAGGGCCGCGTCTTCGTGGCCCGCCGGCCGGGCGAGGCGGACACGGTGGTGCTGAAGGTGGGCCAGA
    AGCCCTCGACGCTGATGGAGGGCATGCTGCTGCAGCGCCTGTCCCACGATAACGTCATGCGCATGAAACA
    GATGCTCGCCCGGGGCCCGGCGACGTGCCTGGTCCTGCCGCACTTTCGGTGCGATCTGTACAGCTACCTG
    ACCATGCGGGACGGGCCGCTGGACATGCGCGACGCCGGGTGCGTGATCCGGGCCGTGCTCCGCGGGCTCG
    CCTACCTGCACGGGATGCGCATCATGCATCGCGACGTCAAGGCGGAGAACATCTTCCTCGAGGACGTGGA
    CACGGTGTGCCTAGGGGACCTCGGGGCCGCGCGCTGCAACGTGGCGGCGCCCAACTTTTACGGGCTCGCC
    GGGACCATCGAGACCAACGCCCCCGAGGTGCTCGCGCGCGACCGCTACGACACCAAGGTCGACGTCTGGG
    GCGCGGGGGTGGTGCTCTTCGAGACGCTGGCCTACCCCAAGACGATCACCGGCGGGGACGAGCCCGCGAT
    CAACGGGGAGATGCACCTGATCGACCTCATCCGCGCCCTCGGGGTGCACCCCGAGGAGTTCCCGCCCGAC
    ACGCGCCTCCGGAGCGAGTTCGTCCGGTACGCCGGGACCCACCGCCAGCCGTACACGCAGTACGCGCGCG
    TGGCTCGCCTCGGGCTGCCCGAGACGGGGGCTTTCCTGATTTACAAGATGTTGACGTTTGATCCCGTCCG
    CCGCCCTTCCGCTGATGAGATACTCAACTTTGGAATGTGGACCGTATAAAACGGGCCGGCTCCGAGCGGT
    AGGACACACACACCTTTGCGCATCTCCACAGCTCAACAATGAAGTGGGCAACGTGGATCCTCGCCCTCGG
    GCTCCTCGTGGTCCGCACCGTCGTGGCCAGAGAGGCCCCTCGGGAGCTCTGCTACGGCCACCCCGTCCAC
    GACGACCGGCGGCCCGTCGGGCCCGCGACCGACGCCCAGCCCGTGAACCCGCTCGCCCCCGCCAACGCCA
    CCGGGACGGACTACTCTCGCGGCTGCGAGATGCGCCTCCTGGATCCGCCTCTCGACGTATCGTCCCGCTC
    CTCGGACCCCGTCAACGTGACCGTCGCCTGGTTCTTTGACGGCGGCCACTGCAAGGTGCCCCTCGTCCAC
    CGCGAGTACTACGGCTGCCCCGGGGACGCCATGCCCTCCGTCGAGACGTGCACCGGCGGGTACTCGTACA
    CCCGCACGCGCATCGACACCCTGATGGAGTACGCCCTCGTGAACGCCAGCCTCGTGCTGCAGCCCGGGCT
    GTACGACGCCGGCCTGTACATCGTCGTGCTCGTCTTTGGCGACGACGCCTACCTCGGCACCGTCTCCCTG
    TCGGTGGAGGCCAACCTGGACTACCCCTGCGGCATGAAGCACGGGCTCACGATCACCCGCCCCGGGGCCA
    CCCTCCCACCCATCGCCCCCACGGCCGGCGACCACCAGCGCTGGCGCGGGTGCTTCCCCTCGACCGACGA
    GGGCGCCTGGGAGAACGTGACCGCCGCCGAGAAGGGCCTGTCCGACGACTACGCCGACTACTACGACGTG
    CACATCTTCCGCTCGGAGTCTGACGACGAGGTCGTCCACGGCGATGCCCCCGAGGCCCCCGAGGGCGAGG
    AGGTGACCGAGGAGGAGGCCGAGCTGACCTCCAGCGACCTCGACAACATCGAGATCGAGGTCGTGGGCTC
    TCCCGCCGCTCCCGCCGAGGGCCCGGCGACGGAGGAGGGGCGCGGGGCCGAGGAGGACGAGGAGCTGACC
    TCCAGCGACCTCGACAACATCGAGATCGAGGTCGTGGGCTCGCCGCGGCCGCCCGCTTCTTCGCCGCCTC
    CACCACCCCCGCGCCCCCACCCGCGCGGCCGAGATCACGACCATGACCACGGTCACCACCGTGCGGACGA
    CCGAGGACCCCAGCGGCATCACCGACTGCCGCCGGAGCCGACCTTCGTCTCGCCCTCTGACATCTTCGTG
    ACCCCCACCGGCAGCCCCGCCCTGCTCCTGGGCTTCCTGGGCAGCGCGCTCGCCTCGCGCCCCCTGCACC
    TGACGGCCGGGGAGACGGCCCAGCACGTGCGCGAGGCCCAGCAGAAGAGCCGCCACATCCGCTCCCTCGG
    CGGCCTCCAGCTCTCGGTCGAGACCGAGACCACCAACACCACCACCACCCAGACGGGCCTGTCGGGCGAC
    ATCCGCACCTCGATCTACATCTGCGTCGCCCTCGCCGGCCTGGTCGTCGTGGGCATCGTCATCATGTGCC
    TCCATATGGCGATCATCAGGGCCCGGGCCCGGAACGACGGCTACCGCCACGTGGCCTCCGCCTGACCCGG
    CCCCGCCCGACTCCCCCGCGATTCCCCCCCTCTCTCACCGGGTGTCCATCTTCAATAA
  • Protein Sequence : Show Sequence
    >gi|126802155|ref|YP_068384.2| serine/threonine protein kinase US3 [Suid herpesvirus 1]
    MADAGIPDEILYSDISDDEIIIDGDGDSSGDEDDDDGGLTRQAAARIVTDLGFEVLQPLQSGSEGRVFVA
    RRPGEADTVVLKVGQKPSTLMEGMLLQRLSHDNVMRMKQMLARGPATCLVLPHFRCDLYSYLTMRDGPLD
    MRDAGCVIRAVLRGLAYLHGMRIMHRDVKAENIFLEDVDTVCLGDLGAARCNVAAPNFYGLAGTIETNAP
    EVLARDRYDTKVDVWGAGVVLFETLAYPKTITGGDEPAINGEMHLIDLIRALGVHPEEFPPDTRLRSEFV
    RYAGTHRQPYTQYARVARLGLPETGAFLIYKMLTFDPVRRPSADEILNFGMWTV
  • Molecule Role : Virmugen
  • Molecule Role Annotation : Researchers intranasally inoculated pigs, the natural host of this virus, with mutant PRV strains in which the genes encoding the protein kinase (US3) proteins were inactivated. After challenge infection with the virulent PRV strain NIA-3, no virus was excreted by wt PRV- and PK- mutant-immunized animals, indicating complete protective immunity (Kimman et al., 1994).
  • Related Vaccine(s): Pseudorabies virus US3 mutant vaccine
16. US6
  • Gene Name : US6
  • Sequence Strain (Species/Organism) : Suid herpesvirus 1
  • VO ID : VO_0011240
  • NCBI Gene ID : 2952521
  • NCBI Protein GI : 51557553
  • Locus Tag : SuHV1_gp68
  • Genbank Accession : BK001744
  • Protein Accession : YP_068387
  • Taxonomy ID : 10345
  • Gene Starting Position : 121023
  • Gene Ending Position : 123397
  • Gene Strand (Orientation) : +
  • Protein Name : envelope glycoprotein D
  • Protein pI : 9.38
  • Protein Weight : 41362.03
  • Protein Length : 400
  • Protein Note : envelope glycoprotein D; the Herpesviridae are non-segmented dsDNA viruses with genomes ranging from 120-230kbp; although herpes viruses vary greatly in sequence identity and homology, they all share four common elements: an envelope, a tegument which is composed of viral enzymes, a capsid of 162 capsomers, and a core composed of genomic DNA;virion envelope glycoproteins bind to cellular receptors; the nonessential glycoprotein gC interacts with cell surface proteoglycans, whereas the essential glycoprotein gD is involved in stable secondary attachment
  • DNA Sequence : Show Sequence
    >gi|51557483:121023-123397 Suid herpesvirus 1, complete genome
    CCATAAAATTGGGTGGGGGCCCCAGGTTCCCATACACTCACCTGCCAGCGCCATGCTGCTCGCAGCGCTA
    TTGGCGGCGCTGGTCGCCCGGACGACGCTCGGCGCGGACGTGGACGCCGTGCCCGCGCCGACCTTCCCCC
    CGCCCGCGTACCCGTACACCGAGTCGTGGCAGCTGACGCTGACGACGGTCCCCTCGCCCTTCGTCGGCCC
    CGCGGACGTCTACCACACGCGCCCGCTGGAGGACCCGTGCGGGGTGGTGGCGCTGATCTCCGACCCGCAG
    GTGGACCGGCTGCTGAACGAGGCGGTGGCCCACCGGCGGCCCACGTACCGCGCCCACGTGGCCTGGTACC
    GCATCGCGGACGGGTGCGCGCACCTGCTGTACTTTATCGAGTACGCCGACTGCGACCCCAGGCAGATCTT
    TGGGCGCTGCCGGCGCCGCACCACGCCGATGTGGTGGACCCCGTCCGCGGACTACATGTTCCCCACGGAG
    GACGAGCTGGGGCTGCTCATGGTGGCTCCGGGGCGGTTCAACGAGGGCCAGTACCGGCGCCTGGTGTCCG
    TCGACGGCGTGAACATCCTCACCGACTTCATGGTGGCGCTCCCCGAGGGGCAAGAGTGCCCGTTCGCCCG
    CGTGGACCAGCACCGCACGTACAAGTTCGGCGCGTGCTGGAACGACGAGAGCTTCAGGCGGGGCGTGGAC
    GTGATGCGATTCCTGACGCCGTTCTACCAGCAGCCCCCGCACCGGGAGGTGGTGAACTACTGGTACCGCA
    AGAACGGCCGGACGCTCCCGCGGGCCTACGCCGCCGCCACGCCGTACGCCATCGACCCCGCGCGGCCCTC
    GGCGGGCTCGCCGAGGCCCAGGCCCCGGCCCCGGCCCCGGCCGAAGCCCGAGCCCGCCCCGGTGACGCCC
    GCGCCCCCCGGCCGCCTGCCCGAGCCGGCGACGCGGGACCACGCCGCCGGGGGCCACCCCACGCCGCGAC
    CCCCGAGGCCCGAGACGCCGCACCGCCCCTTCGCCCCGCCGGCCGTCGTGCCCAGCGGGTGGCCGCAGCC
    CGCGGAGCCGTTCCAGCCGCGGACCCCCGCCGCGCCGGGCGTCTCGCGCCACCGCTCGGTGATCGTCGGC
    ACGGGCACCGCGATGGGCGCGCTCCTGGTGGGCGTGTGCGTCTACATCTTCTTCCGCCTGAGGGGGGCGA
    AGGGGTATCGCCTCCTGGGCGGTCCCGCGGACACCGACGAGCTAAAAGCGCAGCCCGGTCCGTAGCCTCC
    GCAGTACCGGCGTCGATGATGATGGTGGCGCGCGACGTGACCCGGCTCCCCGCGGGGCTCCTCCTCGCCG
    CCCTGACCCTGGCCGCCCTGACCCCGCGCGTCGGGGGCGTCCTCTTCAGGGGCGCCGGCGTCAGCGTGCA
    CGTCGCCGGCAGCGCCGTCCTCGTGCCCGGCGACGCGCCCAACCTGACGATCGACGGGACGCTGCTGTTT
    CTGGAGGGGCCCTCGCCGAGCAACTACAGCGGGCGCGTGGAGCTGCTGCGCCTCGACCCCAAGCGCGCCT
    GCTACACGCGCGAGTACGCCGCCGAGTACGACCTCTGCCCCCGCGTGCACCACGAGGCCTTCCGCGGCTG
    TCTGCGCAAGCGCGAGCCGCTCGCCCGGCGCGCGTCCGCCGCGGTGGAGGCGCGCCGGCTGCTGTTCGTC
    TCGCGCCCGGCCCCGCCGGACGCGGGGTCGTACGTGCTGCGGGTCCGCGTGAACGGGACCACGGACCTCT
    TTGTGCTGACGGCCCTGGTGCCGCCCAGGGGGCGCCCCCACCACCCCACGCCGTCGTCCGCGGACGAGTG
    CCGGCCCGTCGTCGGATCGTGGCACGACAGCCTGCGCGTCGTGGACCCCGCCGAGGACGCCGTGTTCACC
    ACGCCGCCCCCGATCGAGCCAGAGCCGCCGACGACCCCCGCGCCCCCCCGGGGGACCGGCGCCACCCCCG
    AGCCCCGCTCCGACGAAGAGGAGGAGGACGAGGAGGGGGCGACGACGGCGATGACCCCGGTGCCCGGGAC
    CCTGGACGCGAACGGCACGATGGTGCTGAACGCCAGCGTCGTGTCGCGCGTCCTGCTCGCCGCCGCCAAC
    GCCACGGCGGGCGCCCGGGGCCCCGGGAAGATAGCCATGGTGCTGGGGCCCACGATCGTCGTCCTCCTGA
    TCTTCTTGGGCGGGGTCGCCTGCGCGGCCCGGCGCTGCGCGCGGAATCGCATCTACCGGCCGCGACCCGG
    GCGCGGCCCGGCGGTCCACGCGCCGCCCCCGCGGCGCCCGCCCCCCAGCCCCGTCGCCGGGGCGCCCGTC
    CCCCAGCCCAAGATGACGTTGGCCGAGCTTCGCCAGAAGCTGGCCACCATCGCAGAGGAACAATA
  • Protein Sequence : Show Sequence
    >gi|51557553|ref|YP_068387.1| envelope glycoprotein D [Suid herpesvirus 1]
    MLLAALLAALVARTTLGADVDAVPAPTFPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPLEDPCGVVA
    LISDPQVDRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQIFGRCRRRTTPMWWTPSAD
    YMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQHRTYKFGACWNDES
    FRRGVDVMRFLTPFYQQPPHREVVNYWYRKNGRTLPRAYAAATPYAIDPARPSAGSPRPRPRPRPRPKPE
    PAPVTPAPPGRLPEPATRDHAAGGHPTPRPPRPETPHRPFAPPAVVPSGWPQPAEPFQPRTPAAPGVSRH
    RSVIVGTGTAMGALLVGVCVYIFFRLRGAKGYRLLGGPADTDELKAQPGP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The pseudorabies virus (PrV) DNA vaccine carrying the glycoprotein D (gD) gene delivered by E. coli was able to induce protective immune responses in mice against a lethal PrV challenge (Shiau et al., 2001). Immunization of mice with affinity-purified gD of Aujeszky's disease virus (ADV, Suid herpesvirus 1) induced a strong humoral immune response and protected mice against lethal ADV challenge (Vrublevskaia et al., 2007).
1. Ifng (Interferon gamma)
  • Gene Name : Ifng (Interferon gamma)
  • Sequence Strain (Species/Organism) : Mouse
  • NCBI Gene ID : 15978
  • NCBI Protein GI : 33468859
  • Genbank Accession : NM_008337
  • Protein Accession : NP_032363.1
  • Other Database IDs : MGI:107656; UniProt: P01580
  • Taxonomy ID : 10090
  • Gene Strand (Orientation) : ?
  • DNA Sequence : Show Sequence
    >gi|145966741|ref|NM_008337.3| Mus musculus interferon gamma (Ifng), mRNA
    ATAGCTGCCATCGGCTGACCTAGAGAAGACACATCAGCTGATCCTTTGGACCCTCTGACTTGAGACAGAA
    GTTCTGGGCTTCTCCTCCTGCGGCCTAGCTCTGAGACAATGAACGCTACACACTGCATCTTGGCTTTGCA
    GCTCTTCCTCATGGCTGTTTCTGGCTGTTACTGCCACGGCACAGTCATTGAAAGCCTAGAAAGTCTGAAT
    AACTATTTTAACTCAAGTGGCATAGATGTGGAAGAAAAGAGTCTCTTCTTGGATATCTGGAGGAACTGGC
    AAAAGGATGGTGACATGAAAATCCTGCAGAGCCAGATTATCTCTTTCTACCTCAGACTCTTTGAAGTCTT
    GAAAGACAATCAGGCCATCAGCAACAACATAAGCGTCATTGAATCACACCTGATTACTACCTTCTTCAGC
    AACAGCAAGGCGAAAAAGGATGCATTCATGAGTATTGCCAAGTTTGAGGTCAACAACCCACAGGTCCAGC
    GCCAAGCATTCAATGAGCTCATCCGAGTGGTCCACCAGCTGTTGCCGGAATCCAGCCTCAGGAAGCGGAA
    AAGGAGTCGCTGCTGATTCGGGGTGGGGAAGAGATTGTCCCAATAAGAATAATTCTGCCAGCACTATTTG
    AATTTTTAAATCTAAACCTATTTATTAATATTTAAAACTATTTATATGGAGAATCTATTTTAGATGCATC
    AACCAAAGAAGTATTTATAGTAACAACTTATATGTGATAAGAGTGAATTCCTATTAATATATGTGTTATT
    TATAATTTCTGTCTCCTCAACTATTTCTCTTTGACCAATTAATTATTCTTTCTGACTAATTAGCCAAGAC
    TGTGATTGCGGGGTTGTATCTGGGGGTGGGGGACAGCCAAGCGGCTGACTGAACTCAGATTGTAGCTTGT
    ACCTTTACTTCACTGACCAATAAGAAACATTCAGAGCTGCAGTGACCCCGGGAGGTGCTGCTGATGGGAG
    GAGATGTCTACACTCCGGGCCAGCGCTTTAACAGCAGGCCAGACAGCACTCGAATGTGTCAGGTAGTAAC
    AGGCTGTCCCTGAAAGAAAGCAGTGTCTCAAGAGACTTGACACCTGGTGCTTCCCTATACAGCTGAAAAC
    TGTGACTACACCCGAATGACAAATAACTCGCTCATTTATAGTTTATCACTGTCTAATTGCATATGAATAA
    AGTATACCTTTGCAACC
  • Protein Sequence : Show Sequence
    >gi|33468859|ref|NP_032363.1| interferon gamma [Mus musculus]
    MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQI
    ISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQ
    LLPESSLRKRKRSRC
  • Molecule Role Annotation : IFN-gamma plays a critical role in Th1 type immune response. It is important for protection against infections by various viruses and intracellular bacteria.
  • Additional Molecule Role : Vaximmutor
  • Additional Molecule Role Annotation : The experimental data demonstrated that three time vaccinations with BCG in BALB/c mice induced strong TB Ag-specific IFN-gamma immune responses in splenocytes (Wang et al., 2009).
  • Related Vaccine(s): Pseudorabies Subunit gB Protein Vaccine
2. Il2
  • Gene Name : Il2
  • Sequence Strain (Species/Organism) : Mus musculus
  • NCBI Gene ID : 16183
  • NCBI Protein GI : 7110653
  • Locus Tag : DN-144H19.3
  • Genbank Accession : AF195954
  • Protein Accession : NP_032392
  • Taxonomy ID : 10090
  • Chromosome No : 3
  • Gene Starting Position : 37120712
  • Gene Ending Position : 37125953
  • Gene Strand (Orientation) : -
  • Protein Name : interleukin 2
  • Protein pI : 4.63
  • Protein Weight : 18506.61
  • Protein Length : 169
  • Protein Note : Also known as Il-2
  • DNA Sequence : Show Sequence
    >gi|372099107:37120712-37125953 Mus musculus strain C57BL/6J chromosome 3, GRCm38 C57BL/6J
    ATTTTTTTTTAGAGGAGAGCTTTATTTCTTGAAAACACTGATTAACATAGAGTTCACAGGAATAACTGAG
    AAGTTATTTTAGCGCTTACTTTGTGCTGTCCTAAAAATGACAGACATCTGAGCTTATTTATATTTGAATC
    ATCTAAATACTTTTATTAATGAGTCTACCTACACATGATATTTAACAATTCAATATAATAAATAATTTCA
    GATAAATAGTTTAAAACATTTTTGAGCCCTTGGGGCTTACAAAAAGAATCTTTAAAGATCCATATTTATC
    ATCTGAAGACTAGTAGTTACAAAAGATAGTAAACAATACATCCAAAAATAAATTAAAGTTAAATATTTAA
    ATAAATAGAGAGCCTTATGTGTTGTAAGCAGGAGGTACATAGTTATTGAGGGCTTGTTGAGATGATGCTT
    TGACAGAAGGCTATCCATCTCCTCAGAAAGTCCACCACAGTTGCTGACTCATCATCGAATTGGCACTCAA
    ATGTGTTGTCAGAGCCCTAAAAAAGAATATAAAATTGTAGGCTAAGGTAGCTTACTTTGCATATAATTAT
    TCTTCACGGAAGCTTTTAGGCATTTATTTTAACACTGGTTAAATATATTGAACATTCACATTTCTGAAAT
    GATCACAATTATTGGGTTATGTTTTATTATGATATCAAATGGTAAAGCATAAAAAATAAAGCTCTCCAGA
    GTTGATTACCAACGAGCATTTGATGGGAACACTGAACACTTCTGTAGAATTCAGTTGCTTGACCACTTTT
    TCTCTGGTAAGTGTACACAGCTATGCATCAATTTAGGCTTCAGGAATGGAGAAATGATACTTGTTATATG
    TTCTTTGCTAAATCTTAAGAGTCTATTATTCAATTCTTTCCCCCCCAAGTCAGAATGGGAACAACCCAGA
    GTAGGTTAGGACAAGCATCTATTGGGGGAAATTTGGAGAATTTTGTTATAGATATACCTACCCTGATACC
    AGTGTAGATGAATCACAAAGTTTGTACATGTATAAATATTATAAATTTGTTCTGTGGATTAGCTTTTTGA
    AAGCTAACCCTCTTTGCTAAAGGAGATATTTTAATTCTGTTTTTAGGTGACAAGCTGAGAAGGAAATATT
    TTGACAAATTTATGGGATGGCTTTTCCAAATCTGACTAATTCCTTGTAAGTCAAATGAGGCAGATTATTC
    CTTTTAAATAAATACTCCTTTTCAAATAAGCTGCTGTGGTCTTATATACCCTCTTTACATAGCTACTTCA
    ATATTCTAATGTCTTGAATTTTTCATTTTTAAAAATATGTGGCCCTTGAAACATTTTTCTAGTTCTCATG
    TAGCTCTAAAGTTTGTACCATTCATTAGGGGTGAACTTTCTGATGTTGGCCATAGATTTTAGAGCATCCA
    TCTTTGCATACGTAAGTACTCGATTTTAGAGCATCCATCTTAGCATACGTAAGTACTCACACCTTTCAAC
    GTCTAGATGATGTGTATTTCAGCCTGCTTTAAAAACCTCAAATGGAAGCTGGGCAGTGGTGGTGCAGGCC
    TTTAATCCCAGCACTTGGGAGGCAGAGGCAGGCGGATTTCTGAGTTCGAGGCCAGCCTGGTCTACAGAGT
    GAGTTCCAGGACAGCCAGGGCTACACAGAGAAATCCTGTCTCAAAAAAACAAACAAACAAACAAACAAGA
    AACAAACAAACAAAAAAAACAAAAACAAACAAAACAAAACCTCAAATGGAAACAGTGCACTGAAATGTGA
    CTTTGGTTTGGAAAGGACTAGCCCACACCCTCTTGGAGGCTTGCTGCTACTGTCTCACCAGAGTCCATGA
    TTCTTGTGCATTTAAAAACAAAGCTCTGCAGTGGGCTCTCCCCGTCCTGCTCTGTCCATTTTAATGGCTG
    CCATTTTTGGAGAGAAATGTCTGTTTTTCTACCAATACCAGCACAACTTCTCTGGAAAAACTTTTCAGAT
    AATTTTTTCTGATCTGATGAATGTAACACCAGCAAGAGTTGCTTGTTTCTTGTGGAATTCTACTCCGTGC
    TTTCTCTCACATCCAGTTCTATGCTGGTGTGGAGGGAGCAGAGTGTTCATGTTCCCAGTTTCCTTGCAGG
    TGATGGTAGGTGGAAATTCTAGCATCATCCTACAGTGGAAGGATTCACTTGCACAGTGACTTTAAACTTT
    GGCTGACTAAATGCACAGAACCCATCAAAGACCAGAAATGGCAAGCCACTTAAAAATGCATTTCTTCTCT
    ATTTTATTTCCAGATTAGCAAATAAAGCAACACCTTACCTTTAGTTTTACAACAGTTACTCTGATATTGC
    TGATGAAATTCTCAGCATCTTCCAATTGAAAGCTTTTGCTTTGAGTCAAATCCAGAACATGCCGCAGAGG
    TCCAAGTTCATCTTCTAGGCACTGAAGATCTTTCAATTCTGTGGCCTAGAGGAGTAATAAGCTTAACCAT
    CAGCTCAGCTCACCACATACTGAAGAGCCAGAAAGTTAGTCTGCAGTCTCTCTAATCAAGAGAAGGCAGC
    ACATAGCTTTTACCACTCCCTGTCCTCTGTAAAGGGGGACTGAGGTAATCGATGCCATAAATCTAGAAGA
    GCAAGAGCTCACAACCATAAGGGTCACCTTGACTGTTAGGCCACTCTAGTGAGCTCTTCTGGCTTCATTA
    GACTTTGTAAAAAGTCTGTGTTTCTCTACCAATGCATAGCACAAGTTCAGACTATTGTTCCAATCTACAA
    AGAAATCTGCAAGGTTCACATTCTAATATCTAATCGCAGAGTTGAGAATCACAGAAGGGTAAGGGACAGG
    AATCCTTGGATGCCAACTGTCATAGGCCTAAATCTTACAGATTAGGTTATCATGGCCCTGACTGAGGGGT
    GTCAAGATAGCCAGGAAGACACATGTAATATTTTTTAAATTTATACTTCTCTGCAATTACTAAAGATGAG
    TTTTTTAAAAACCCATATGTCAAGCTAGGAAGATGGCTTTTAAGGTAAAGGTACCTGCCACCAAACTTGA
    TGATTTGAGTTCAATTGCAGTGACCCACCCACATTGTGGAAAGAATGGCCCAACTTTCATATTTCGTCTT
    CTGACCTCCACAGTTACACTGTGATACACATGCACCTCCACACATACATACATACATACATACATACATA
    CATACATACATACATACATACATACATAAAATGTAAAATCTATTTGTCCCAATGAAAAAAGTCATAACAT
    TTTGGCAGAACACTTGGGAGAATTTTTCTGATCCATGTATGAAATAATGTTTAAATACATCATGCATACT
    TACATACATATACAGGGAAAAAGGATATTGTCTAGCTCTATAGTACACTATGATTTCCATAAAGTCAGCT
    GCTTTAAGTCTACAGTGAACTGTGTTATCTCCATTTTACCAAGTCTCACAATCAGTGTCTTTCCCACAAC
    CACATGAACGGGGAGCAAGGGTGGCCCGGTCGGTCGGTCGCTCCTTTCATTAACCACAGCCTTTGAATTA
    CATGCTTCTATTGTTTTTAAAATCTTACATACCGAATGCAGGTTAAATGAAAACATCAGCAGAATTTACC
    ACATTACTCTTGTTTTCAATAATTATTTTAAAACTTAGATTTCTAGGAATTTCACCACTCTCTAAATTAA
    CATGATCTCTGTTGTTTCTCTAACAATCCTTAGAGGAAGAGGTTTGACAAGATAACACGTAGTTCCTGAT
    TGGTCTGCTATTGACCTTCCAACTTGTTATGGTGTGTCTTGGGTATTCAGTGTGGAGCTCCTTCCCTCAC
    AGAACTCTCCAGTTTGTTACTGTGGGAGCTGAACATTATGTGACTGTAATTAAGCTGGAAGAGCAACTGG
    GGCCTTTCTTTTTCATCTCCTGTAGAACAGCTAGAGGCAAAGTTCCCCTGACTCAATAGGAATGGGTCAA
    CAGCTGCCTCTTTGTCCCCTTAGATCCCATTTTGCTCTAGGCTTGGATTTACTTGGGACAAGCTCTTTCT
    AGGACCAAAGTTATCCATTCTCTTTTGACTTTCGGGACTAGAGCAAATTTCTACCCTTGCTGGAGTTCTA
    AGAGCTTGTGTAAGCTGTTTTGTATCACACAACATTCTGCCTCCAAAGGAGACCAAAAAACCTTTCAATA
    TTGAGAGATAGTATCATGTAGTAATATTACAGCTCTCTAGTTCCACTAGTTAAAAGAGACTGTATAAATC
    CAAAATTGTTTTATACATCTCGGACTTCTTCTCTAGCACTAATAGTGTGTTTATGTGCTGTTGGCCAGAC
    ACTGTTCTGAAACCTGACAAGTGATAAGCATAGCAATGATCATTTATGTAAGTGGGTGAATGAGCATAGA
    CAACTTCCTGAGGCCATGAGAGCTAGGCCCTAGCAGGGCTGGACTCCACTGCAGATCATTGGCCCTAGAA
    TCTTAACATTGGTTATGCTGCTCCTCAAAAATGCAGTCATAGGAATCATTCTTAAAACAGTAAAGTGTGT
    GTAAAATGAGACCCTCTCAAGTCAATTTTTACATTTAAGAAGCTGAAATAATGCACCTCTCTCAAATATC
    TGTAGGACAAGCATAAAACAGAAATCAACAGTCTTTAAATTATCCCAGCATCAAAATGCAATCATCTTGC
    ATTTTCTTCTCATTCCCTTTCCCAACACATAAATACACAGGAAAAATGTAAAGAAAACCATTTAAAAGAA
    GTACCATTGTCAAGATTTTTTTACAGAGAGATATCAGAGAAACTTATTTTCTTCAGATGAGGTACTATTC
    ATCTGGTCACATGTTATTTACACGTTATACACATGTATGTTACTTTGAATTCATTAGAGCACCAGTTAAA
    CACAGAAACTCACTCACCTGCTTGGGCAAGTAAAATTTGAAGGTGAGCATCCTGGGGAGTTTCAGGTTCC
    TGTAATTCTGAGAAAGCGTAACACATTATTATTAAAGGTTATTAAACACAGCCTTTGGCAAGAAAGCTAA
    AGGTATTGCCTATAGATGGGATGGCTGTGCACTTACCTCCATCCTGCTCAGGAGCTCCTGTAGGTCCATC
    AACAGCTGCTCCAGGTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGCTGTGCTTCCGCTGTAGAGC
    TTGAAGTGGAGCTTGAAGTGGGTGCGCTGTTGACAAGGAGCACAAGTGTCAATGTGACACAGGATGCGAG
    CTGCATGCTGTACATGCCTGCAGGACTTGAGGTCACTGTGAGGAGTGATTAGCAAGGGTGAT
  • Protein Sequence : Show Sequence
    >gi|7110653|ref|NP_032392.1| interleukin-2 precursor [Mus musculus]
    MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKL
    PRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFEC
    QFDDESATVVDFLRRWIAFCQSIISTSPQ
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Pseudorabies Subunit gB Protein Vaccine
3. Il4 (interleukin 4)
  • Gene Name : Il4 (interleukin 4)
  • Sequence Strain (Species/Organism) : Mus musculus
  • NCBI Gene ID : 16189
  • NCBI Protein GI : 10946584
  • Locus Tag : RP23-188H3.4
  • Genbank Accession : NM_021283.1
  • Protein Accession : NM_021283.1
  • Taxonomy ID : 10090
  • Gene Strand (Orientation) : ?
  • Protein Name : IL-4, Interleukin 4
  • DNA Sequence : Show Sequence
    >gi|10946583|ref|NM_021283.1| Mus musculus interleukin 4 (Il4), mRNA
    GGATCCCCGGGCAGAGCTGGGGGGGGATTTGTTAGCATCTCTTGATAAACTTAATTGTCTCTCGTCACTG
    ACGGCACAGAGCTATTGATGGGTCTCAACCCCCAGCTAGTTGTCATCCTGCTCTTCTTTCTCGAATGTAC
    CAGGAGCCATATCCACGGATGCGACAAAAATCACTTGAGAGAGATCATCGGCATTTTGAACGAGGTCACA
    GGAGAAGGGACGCCATGCACGGAGATGGATGTGCCAAACGTCCTCACAGCAACGAAGAACACCACAGAGA
    GTGAGCTCGTCTGTAGGGCTTCCAAGGTGCTTCGCATATTTTATTTAAAACATGGGAAAACTCCATGCTT
    GAAGAAGAACTCTAGTGTTCTCATGGAGCTGCAGAGACTCTTTCGGGCTTTTCGATGCCTGGATTCATCG
    ATAAGCTGCACCATGAATGAGTCCAAGTCCACATCACTGAAAGACTTCCTGGAAAGCCTAAAGAGCATCA
    TGCAAATGGATTACTCGTAGTACTGAGCCACCATGCTTTAACTTATGAATTTTTAATGGTTTTATTTTAA
    TATTTATATATTTATAATTCATAAAATAAAATATTTGTATAATGT
  • Protein Sequence : Show Sequence
    >gi|10946584|ref|NP_067258.1| interleukin 4 [Mus musculus]
    MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCR
    ASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
  • Molecule Role : Vaximmutor
  • Molecule Role Annotation : IL-4 plays an important role in Th2 immune response.
  • Related Vaccine(s): Pseudorabies Subunit gB Protein Vaccine
IV. Vaccine Information
1. NYVAC-PRV- gII/ gp50
a. Vaccine Ontology ID:
VO_0004778
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of GII
  • Type: Recombinant vector construction
  • Description: A NYVAC vaccinia vector containing genes for pseudorables virus glycoproteins gII and gp50 (Brockmeier and Mengeling, 1996).
  • Detailed Gene Information: Click here.
f. Gene Engineering of gp50
  • Type: Recombinant vector construction
  • Description: A NYVAC vaccinia vector containing genes for pseudorables virus glycoproteins gII and gp50 (Brockmeier and Mengeling, 1996).
  • Detailed Gene Information: Click here.
g. Preparation
(Brockmeier and Mengeling, 1996) A NYVAC vaccinia vector containing genes for PRV gII and gp50 .
h. Immunization Route
Intramuscular injection (i.m.)
i. Pig Response
  • Vaccination Protocol: The pigs were vaccinated via intramuscular injection in the thigh with 107 CCID50 of NYVAC/gp50 or NYVAC/gpII,gp50, 4 weeks apart (Brockmeier and Mengeling, 1996).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Vaccinated pigs were challenged with 108 PFU of Indiana-Funkhauser strain of PRV oronasally, 4 weeks after the second vaccination (Brockmeier and Mengeling, 1996).
  • Efficacy: Both NYVAC vectors protected pigs similarly from virulent pseudorabies virus challenge (Brockmeier and Mengeling, 1996).
2. Pseduorabies Subunit Glycoprotein C Vaccine
a. Vaccine Ontology ID:
VO_0004155
b. Type:
Subunit vaccine
c. Status:
Research
d. Gene Engineering of UL44
  • Type: Recombinant protein preparation
  • Description: Psuedorabies glycoprotein C was purified from pseudorabies infected cell lysates (Katayama et al., 1997).
  • Detailed Gene Information: Click here.
e. Immunization Route
Intramuscular injection (i.m.)
f. Pig Response
  • Vaccination Protocol: Pigs of each group were immunized intramuscularly with one ml of the different trial vaccines at two week intervals. Control pigs were vaccinated with unifected cell lysate antigens (Katayama et al., 1997).
  • Challenge Protocol: One week after immunization pigs were challenged intranasally with 106 TCID50 of PRV Yamagata S-81 strain (Katayama et al., 1997).
  • Efficacy: Immunized pigs had a high (87.5%) rate of survival against lethal PRV challenge (Katayama et al., 1997).
3. Pseudorabies Modified Live Virus Vaccine (USDA: 1891.20)
a. Manufacturer:
Wyeth, Boehringer Ingelheim Vetmedica, Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001806
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
4. Pseudorabies Modified Live Virus Vaccine (USDA: 1891.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001807
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
5. Pseudorabies Modified Live Virus Vaccine (USDA: 1891.R2)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001808
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
6. Pseudorabies Modified Live Virus Vaccine (USDA: 1891.R4)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001809
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
7. Pseudorabies recombinant vector vaccine encoding gp50 and gII protein
a. Vaccine Ontology ID:
VO_0004156
b. Type:
Recombinant vector vaccine
c. Status:
Licensed
d. Gene Engineering of Gp50
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Gene Engineering of GII
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
NYVAC vaccinia vector (Brockmeier and Mengeling, 1996).
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Vaccination Protocol: 4-6 wk old male pigs from a PRV negative herd were vaccinated intramuscularly with two injections in the thigh of 107 CCID50 of NYVAC/gp50gpII 4 weeks apart. The control group was not vaccinated (Brockmeier and Mengeling, 1996).
  • Challenge Protocol: Challenge consisted of administering 108 PFU of Indiana-Funkhauser strain of PRV oranasally, 4 weeks after the 2nd immunization (Brockmeier and Mengeling, 1996).
  • Efficacy: Vaccinated pigs were protected from PRV challenge (Brockmeier and Mengeling, 1996).
8. Pseudorabies recombinant vector vaccine encoding gp50 protein
a. Vaccine Ontology ID:
VO_0004003
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of Gp50
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
NYVAC vaccinia vector (Brockmeier and Mengeling, 1996).
f. Immunization Route
Intramuscular injection (i.m.)
g. Pig Response
  • Vaccination Protocol: 4-6 wk old male pigs from a PRV negative herd were vaccinated intramuscularly with two injections in the thigh of 107 CCID50 of NYVAC/gpSO 4 weeks apart. The control group was not vaccinated (Brockmeier and Mengeling, 1996).
  • Challenge Protocol: Challenge consisted of administering 108 PFU of Indiana-Funkhauser strain of PRV oranasally, 4 weeks after the 2nd immunization (Brockmeier and Mengeling, 1996).
  • Efficacy: Vaccinated pigs were protected from PRV challenge (Brockmeier and Mengeling, 1996).
9. Pseudorabies Subunit gB Protein Vaccine
a. Vaccine Ontology ID:
VO_0004041
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Gene Engineering of GB
  • Type: Recombinant vector construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
Replication-incompetent adenovirus (Han et al., 2008).
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Host Strain: C57BL/6
  • Vaccination Protocol: Groups of female mice were immunized with replication-incompetent adenoviruses expressing PrV glycoprotein (rAd-gB) by either the intranasal (i.n.) or intramuscular (i.m.) route. For i.m. administration, recombinant adenoviruses (106 pfu/mouse) were injected into the anterior tibialis muscle three times at weekly intervals (0, 7, and 14 days). The i.n. immunizations were also performed three times at weekly intervals (0, 7, and 14 days) by depositing 106 pfu of recombinant adenovirus onto the nares of deeply anesthetized mice. Control mice were immunized with replication-incompetent adenovirus expressing the LacZ gene (rAd-LacZ) (Han et al., 2008).
  • Challenge Protocol: The immunized mice were infected i.n. with the virulent PrV YS strain (10 LD50) two weeks after the final immunization. The challenged mice were examined daily to quantify the number of dead animals. Mice generally began to exhibit clinical signs of illness 3 to 4 days post-challenge (Han et al., 2008).
  • Efficacy: Recombinant adenovirus expressing gB (rAd-gB) was found to induce effective protective immunity against a virulent viral infection, regardless of whether it was administered via the muscular or systemic route (Han et al., 2008).
  • Host Gene Response of Ifng (Interferon gamma)
    • Gene Response: In splenocytes and popliteal lymph node cells, IFN-gamma was induced to a significantly higher level in immunized animals as compared to replication-incompetent adenovirus expressing LacZ (rAd-LacZ) vaccinated mice. These elevated levels were detected 2 weeks after the final immunization
    • Detailed Gene Information: Click here.
  • Host Gene Response of Il2
    • Gene Response: In splenocytes and popliteal lymph node cells, IL-2 was induced to a significantly higher level in immunized animals as compared to replication-incompetent adenovirus expressing LacZ (rAd-LacZ) vaccinated mice. These elevated levels were detected 2 weeks after the final immunization (Han et al., 2008).
    • Detailed Gene Information: Click here.
  • Host Gene Response of Il4 (interleukin 4)
    • Gene Response: In splenocytes and popliteal lymph node cells, IL-4 was induced to a significantly higher level in immunized animals as compared to replication-incompetent adenovirus expressing LacZ (rAd-LacZ) vaccinated mice. These elevated levels were detected 2 weeks after the final immunization (Han et al., 2008).
    • Detailed Gene Information: Click here.
10. Pseudorabies Subunit gI Protein Vaccine
a. Vaccine Ontology ID:
VO_0004040
b. Type:
Subunit vaccine
c. Status:
Research
d. Gene Engineering of GI
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
e. Immunization Route
Intramuscular injection (i.m.)
f. Mouse Response
  • Host Strain: C57BL/10
  • Vaccination Protocol: For active immunization mice were injected i.m. (hind leg) with different concentrations of emulsified purified (by electroelution) fusion protein (Fuchs et al., 1990).
  • Challenge Protocol: Twenty-four h later the animals were infected intramuscularly (i.m.) into a hind leg using 0-1 ml of a lethal dose ( > 100 LD50) of strain Phylaxia, and the mice were observed for at least 10 days (Fuchs et al., 1990).
  • Efficacy: Vaccination of mice with fusion proteins containing the N terminus of gI from Suid herpesvirus 1 are able to confer protection to mice against a lethal challenge of PRV (Fuchs et al., 1990).
11. Pseudorabies virus glycoprotein E/G/UL23 mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Raccoon
d. Gene Engineering of glycoprotein G
  • Type: Gene mutation
  • Description: This glycoprotein E/G/UL23 mutant is from Suid herpesvirus 1 (Weigel et al., 2003).
  • Detailed Gene Information: Click here.
e. Gene Engineering of glycoprotein E
  • Type: Gene mutation
  • Description: This glycoprotein E/G/UL23 mutant is from Suid herpesvirus 1 (Weigel et al., 2003).
  • Detailed Gene Information: Click here.
f. Gene Engineering of UL23
  • Type: Gene mutation
  • Description: This glycoprotein E/G/UL23 mutant is from Suid herpesvirus 1 (Weigel et al., 2003).
  • Detailed Gene Information: Click here.
g. Immunization Route
intranasal immunization
h. Raccoon Response
  • Persistence: A glycoprotein E/G/UL23 is attenuated in raccoons (Weigel et al., 2003).
  • Efficacy: A glycoprotein E/G/UL23 mutant provides some protection in raccoons from challenge with wild type Pseudorabies virus (Weigel et al., 2003).
12. Pseudorabies virus gp50/gp63 mutant vaccine
a. Type:
Live, attenuated vaccine
b. Status:
Research
c. Host Species as Laboratory Animal Model:
Pig
d. Gene Engineering of gp50
e. Gene Engineering of gp63
f. Immunization Route
Intramuscular injection (i.m.)
g. Pig Response
  • Persistence: A gp50/gp63 mutant is attenuated in pigs (Peeters et al., 1994).
  • Efficacy: A gp50/gp63 mutant vaccine induces protection in pigs from challenge with wild type Pseudorabies virus (Peeters et al., 1994).
13. Pseudorabies virus UL50 mutant vaccine
a. Vaccine Ontology ID:
VO_0002989
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of UL50
f. Immunization Route
intranasal immunization
g. Pig Response
  • Persistence: A UL50 mutant is attenuated in pigs (Jöns et al., 1997).
  • Efficacy: A UL50 mutant induces protection in pigs from challenge with wild type Pseudorabies virus (Jöns et al., 1997).
14. Pseudorabies virus US3 mutant vaccine
a. Vaccine Ontology ID:
VO_0002990
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of US3
f. Immunization Route
intranasal immunization
g. Pig Response
  • Persistence: A US3 mutant is attenuated in pigs (Kimman et al., 1994).
  • Efficacy: A US3 mutant induces complete protection in pigs from challenge with wild type Pseudorabies virus (Kimman et al., 1994).
15. Psuedorabies DNA vaccine encoding IE180 protein
a. Vaccine Ontology ID:
VO_0004039
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of IE180
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pcDNA3.1 (Chang et al., 1998)
f. Immunization Route
Gene Gun
g. Mouse Response
  • Host Strain: BALB/c, C3H/HeJ, and C57BL/6
  • Vaccination Protocol: Two shots of DNA/mouse (1 /Ag/shot) were delivered with helium at 200 psi via the Helios Gene Gun to the shaven abdominal skin of 10 male mice of each strain, BALB/c, C57BL/6, C3H/HeJ. The mice received a booster once 14 days later with the same dose of DNA. In some experiments, pregnant mice of each strain were vaccinated immediately before mating and a booster was given 2 weeks later (Chang et al., 1998).
  • Challenge Protocol: Six months after second vaccination, groups of pcDNAIE180 immunized mice were challenged intraperitoneally with a precalibrated mouse acute lethal dose of wild-type PrV-Ka TK+ (15 plaque-forming units (PFU)/g of body weight). The challenged mice were observed three times daily for clinical signs, and percent survival was assessed within 4 to 5 days postchallenge (Chang et al., 1998).
  • Efficacy: Seven months after immunization with pcDNAIE180, an overall 25% of BALB/c, C3H/HeJ, and C57BL/6 mice receiving a lethal PrV challenge were protected (Chang et al., 1998).
16. Psuedorabies virus glycoprotein M mutant vaccine
a. Vaccine Ontology ID:
VO_0002985
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of glycoprotein M
f. Immunization Route
intranasal immunization
g. Pig Response
  • Persistence: A glycoprotein M mutant is attenuated in piglets (Dijkstra et al., 1997).
  • Efficacy: A glycoprotein M mutant induces protection in piglets from challenge with wild type Pseudorabies virus (Dijkstra et al., 1997).
17. rORFV-PRV-gC/gD
a. Vaccine Ontology ID:
VO_0004770
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
Based on the attenuated ORFV strain D1701-V, recombinants were produced that express the glycoproteins gC (D1701-VrVgC) or gD (D1701-VrVgD) of the alphaherpesvirus of swine, pseudorabies virus (PRV) (Fischer et al., 2003).
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccination Protocol: Mice were injected intramuscularly (i.m.) with 107 TCID50s of the ORFV recombinants expressing the PRV glycoproteins in a total volume of 0.2 ml (0.1 ml for each hind leg). Immunization was repeated at 2-week intervals (Fischer et al., 2003).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Mice were challenge infected intraperitoneally (i.p.) with 102 PFU of the highly virulent PRV strain NIA-3, and the C57BL/6 and 129/Sv/Ev mice were infected with 103 PFU
  • Efficacy: Single or combined immunization with the ORFV recombinants protected different mouse strains of a host species nonpermissive for ORFV against a fulminant, lethal PRV challenge infection equal to immunization with PRV live vaccine. Most notably, even a single immunization with D1701-VrVgC was protective, whereas two applications of D1701-VrVgD were required for immune protection (Fischer et al., 2003).
18. Suvaxyn Aujeszky
a. Tradename:
Suvaxyn Aujeszky
b. Manufacturer:
Fort Dodge
c. Vaccine Ontology ID:
VO_0000936
d. Type:
Inactivated or "killed" vaccine
e. Status:
Licensed
f. Host Species for Licensed Use:
Pig
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
gE- and thymidine kinase-deleted marker vaccine(Ferrari et al., 2000)
V. References
1. Brockmeier and Mengeling, 1996: Brockmeier SL, Mengeling WL. Comparison of the protective response induced by NYVAC vaccinia recombinants expressing either gp50 or gII and gp50 of pseudorabies virus. Canadian journal of veterinary research = Revue canadienne de recherche veterinaire. 1996; 60(4); 315-317. [PubMed: 8904669].
2. Chang et al., 1998: Chang SW, Bu J, Rompato G, Garmendia AE. A vector DNA vaccine encoding pseudorabies virus immediate early protein demonstrates partial protection in mice against lethal virus challenge. Viral immunology. 1998; 11(1); 27-36. [PubMed: 9586695].
3. Dijkstra et al., 1997: Dijkstra JM, Gerdts V, Klupp BG, Mettenleiter TC. Deletion of glycoprotein gM of pseudorabies virus results in attenuation for the natural host. The Journal of general virology. 1997; 78 ( Pt 9); 2147-2151. [PubMed: 9292000].
4. Eo et al., 2006: Eo SK, Yoon HA, Aleyas AG, Park SO, Han YW, Chae JS, Lee JH, Song HJ, Cho JG. Systemic and mucosal immunity induced by oral somatic transgene vaccination against glycoprotein B of pseudorabies virus using live attenuated Salmonella typhimurium. FEMS immunology and medical microbiology. 2006; 47(3); 451-461. [PubMed: 16872383].
5. Ferrari et al., 2000: Ferrari M, Brack A, Romanelli MG, Mettenleiter TC, Corradi A, Dal Mas N, Losio MN, Silini R, Pinoni C, Pratelli A. A study of the ability of a TK-negative and gI/gE-negative pseudorabies virus (PRV) mutant inoculated by different routes to protect pigs against PRV infection. Journal of veterinary medicine. B, Infectious diseases and veterinary public health. 2000; 47(10); 753-762. [PubMed: 11204130].
6. Fischer et al., 2003: Fischer T, Planz O, Stitz L, Rziha HJ. Novel recombinant parapoxvirus vectors induce protective humoral and cellular immunity against lethal herpesvirus challenge infection in mice. Journal of virology. 2003; 77(17); 9312-9323. [PubMed: 12915547].
7. Fuchs et al., 1990: Fuchs W, Rziha HJ, Lukàcs N, Braunschweiger I, Visser N, Lütticken D, Schreurs CS, Thiel HJ, Mettenleiter TC. Pseudorabies virus glycoprotein gI: in vitro and in vivo analysis of immunorelevant epitopes. The Journal of general virology. 1990; 71 ( Pt 5); 1141-1151. [PubMed: 1693164].
8. Grabowska et al., 2009: Grabowska AK, Lipińska AD, Rohde J, Szewczyk B, Bienkowska-Szewczyk K, Rziha HJ. New baculovirus recombinants expressing Pseudorabies virus (PRV) glycoproteins protect mice against lethal challenge infection. Vaccine. 2009; 27(27); 3584-3591. [PubMed: 19464538].
9. Han et al., 2008: Han YW, Aleyas AG, George JA, Kim SJ, Kim HK, Yoon HA, Yoo DJ, Kang SH, Kim K, Eo SK. Polarization of protective immunity induced by replication-incompetent adenovirus expressing glycoproteins of pseudorabies virus. Experimental & molecular medicine. 2008; 40(6); 583-595. [PubMed: 19116444].
10. Jöns et al., 1997: Jöns A, Gerdts V, Lange E, Kaden V, Mettenleiter TC. Attenuation of dUTPase-deficient pseudorabies virus for the natural host. Veterinary microbiology. 1997; 56(1-2); 47-54. [PubMed: 9228681].
11. Katayama et al., 1997: Katayama S, Okada N, Yoshiki K, Okabe T, Shimizu Y. Protective effect of glycoprotein gC-rich antigen against pseudorabies virus. The Journal of veterinary medical science / the Japanese Society of Veterinary Science. 1997; 59(8); 657-663. [PubMed: 9300361].
12. Kimman et al., 1994: Kimman TG, De Wind N, De Bruin T, de Visser Y, Voermans J. Inactivation of glycoprotein gE and thymidine kinase or the US3-encoded protein kinase synergistically decreases in vivo replication of pseudorabies virus and the induction of protective immunity. Virology. 1994; 205(2); 511-518. [PubMed: 7975253].
13. Matsuda et al., 1992: Matsuda Tsuchida A, Katayama S, Okada N, Okabe T, Sasaki N. Protection from pseudorabies virus challenge in mice by a combination of purified gII, gIII and gVI antigens. The Journal of veterinary medical science / the Japanese Society of Veterinary Science. 1992; 54(3); 447-452. [PubMed: 1322712].
14. Merck Vet Manual: Pseudorabies: Merck Veterinary Manual- Pseudorabies [http://www.merckvetmanual.com/mvm/index.jsp?cfile=htm/bc/102200.htm]
15. Peeters et al., 1994: Peeters B, Bouma A, de Bruin T, Moormann R, Gielkens A, Kimman T. Non-transmissible pseudorabies virus gp50 mutants: a new generation of safe live vaccines. Vaccine. 1994; 12(4); 375-380. [PubMed: 8178562].
16. Shiau et al., 2001: Shiau AL, Chu CY, Su WC, Wu CL. Vaccination with the glycoprotein D gene of pseudorabies virus delivered by nonpathogenic Escherichia coli elicits protective immune responses. Vaccine. 2001; 19(23-24); 3277-3284. [PubMed: 11312026].
17. Vrublevskaia et al., 2007: Vrublevskaia VV, Musienko VS, Skarga IuIu, Morenkov OS. [Immunological characteristics of Aujeszky's disease virus glycoprotein]. Voprosy virusologii. 2007; 52(3); 33-37. [PubMed: 17601050].
18. Weigel et al., 2003: Weigel RM, Hahn EC, Scherba G. Survival and immunization of raccoons after exposure to pseudorabies (Aujeszky's disease) virus gene-deleted vaccines. Veterinary microbiology. 2003; 92(1-2); 19-24. [PubMed: 12488067].
19. Wiki: Pseudorabies: Pseudorabies [http://en.wikipedia.org/wiki/Pseudorabies]