VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Classical swine fever virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. E0 (Protective antigen)
    2. E2 (Protective antigen)
    3. E2 (Protective antigen)
    4. gp55 (Protective antigen)
    5. E(rns) (Virmugen)
    6. E1 (Virmugen)
    7. E2 (Virmugen, Protective antigen)
  3. Vaccine Information
    1. Bayovac CSF E2
    2. Classical Swine Fever Virus DNA Vaccine pcDNA/E2 with TRIF
    3. Classical swine fever virus DNA vaccine pCI-gp55
    4. Classical swine fever virus E(rns) mutant vaccine
    5. Classical swine fever virus E1 mutant vaccine
    6. Classical swine fever virus E1 protein vaccine
    7. Classical swine fever virus E2 mutant vaccine
    8. Classical swine fever virus vaccine VAC-E0
    9. Classical swine fever virus vaccine VAC-E2
    10. DNA vaccine expressing the E2 protein
    11. Porcilis Pesti
    12. rAdV-SFV-E2
    13. rORFV-CSFV-E2
    14. rPFV-CSFV-E0
  4. References
I. General Information
1. NCBI Taxonomy ID:
11096
2. Disease:
Classical swine fever, hog cholera
3. Introduction
CSFV is closely related to the ruminant pestiviruses which cause Bovine Viral Diarrhoea (BVDV) and Border Disease (BDV). The effect of different CSFV strains varies widely, leading to a wide range of symptoms. Highly virulent strains correlate with acute, obvious disease and high mortality, including neurological symptoms and hemorrhages within the skin.

Less virulent strains can give rise to subacute or chronic infections that may escape detection, while still inducing mortality in fetuses and neonates. Infected piglets birthed from infected but subclinical sows help maintain the disease within a population. Other symptoms can include lethargy, fever, immunosuppression and secondary respiratory infections. The incubation period of CSFV ranges from 2 to 14 days, but symptoms may not be apparent until after 2 to 4 weeks. Animals with an acute infection can survive 2 to 3 months before their eventual death.

Eradicating CSF is problematic. Current programmes revolve around rapid detection and diagnosis, and preventive culling, possibly followed by emergency vaccination (ATCvet codes: QI09AA06 for the inactivated viral vaccine, QI09AD04 for the live vaccine). Possible sources for maintaining and introducing infection include the wide transport of pigs and pork products, as well as endemic CSF within wild boar and feral pig populations (Wiki: Classical swine fever).
4. Host Ranges and Animal Models
Swine fever is is a highly contagious disease of pigs and wild boar (Wiki: Classical swine fever).
1. E(rns)
  • Gene Name : E(rns)
  • Sequence Strain (Species/Organism) : Classical swine fever virus - Brescia
  • NCBI Protein GI : 130457
  • Other Database IDs : CDD:147625
    CDD:152325
    CDD:185828
    CDD:29472
    CDD:152822
    CDD:114308
    CDD:31829
    CDD:28927
    CDD:73158
  • Taxonomy ID : 11098
  • Gene Strand (Orientation) : ?
  • Protein Name : Genome polyprotein
  • Protein Note : N-terminal protease (By similarity). /FTId=PRO_0000038062.
  • Protein Sequence : Show Sequence
    >gi|130457|sp|P21530.1|POLG_CSFVB RecName: Full=Genome polyprotein; Contains: RecName: Full=N-terminal protease; Short=N-pro; AltName: Full=Autoprotease p20; Contains: RecName: Full=Capsid protein C; Contains: RecName: Full=E(rns) glycoprotein; AltName: Full=gp44/48; Contains: RecName: Full=Envelope glycoprotein E1; AltName: Full=gp33; Contains: RecName: Full=Envelope glycoprotein E2; AltName: Full=gp55; Contains: RecName: Full=p7; Contains: RecName: Full=Non-structural protein 2-3; Short=NS2-3; Contains: RecName: Full=Cysteine protease NS2; AltName: Full=Non-structural protein 2; Contains: RecName: Full=Serine protease NS3; AltName: Full=Non-structural protein 3; Contains: RecName: Full=Non-structural protein 4A; Short=NS4A; Contains: RecName: Full=Non-structural protein 4B; Short=NS4B; Contains: RecName: Full=Non-structural protein 5A; Short=NS5A; Contains: RecName: Full=RNA-directed RNA polymerase; AltName: Full=NS5B
    MELNHFELLYKTNKQKPMGVEEPVYDVTGRPLFGDPSEVHPQSTLKLPHDRGRGNIKTTLKNLPRRGDCR
    SGNHLGPVSGIYVKPGPVFYQDYMGPVYHRAPLEFFDEAQFCEVTKRIGRVTGSDGKLYHIYVCIDGCIL
    LKLAKRGEPRTLKWIRNLTDCPLWVTSCSDDGASASKEKKPDRINKGKLKIAPKEHEKDSRTKPPDATIV
    VEGVKYQVKKKGKVKGKNTQDGLYHNKNKPPESRKKLEKALLAWAVIAIMLYQPVAAENITQWNLRDNGT
    NGIQHAMYLRGVSRSLHGIWPEKICKGVPTYLATDTELREIQGMMVASEGTNYTCCKLQRHEWNKHGWCN
    WYNIDPWIQLMNRTQANLAEGPPSKECAVTCRYDKNADINVVTQARNRPTTLTGCKKGTNFSFAGTVIEG
    PCNFNVSVEDILYGDHECGSLLQDTALYLVDGMTNTIERARQGAARVTSWLGRQLRIAGKRLEGRSKTWF
    GAYALSPYCNVTTKIGYIWYTNNCTPACLPKNTKIIGPGKFDTNAEDGKILHEMGGHLSEFLLLSLVVLS
    DFAPETASALYLILHYVIPQSHEEPEGCDTNQLNLTVELRTEDVIPSSVWNVGKYVCVRPDWWPYETKVA
    LLFEEAGQVVKLALRALRDLTRVWNSASTTAFLICLIKVLRGQVVQGVIWLLLVTGAQGRLACKEDHRYA
    ISTTNEIGLHGAEGLTTTWKEYNHNLQLDDGTVKAICMAGSFKVTALNVVSRRYLASLHKDALPTSVTFE
    LLFDGTSPLTEEMGDDFGFGLCPYDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECTAVSPTTLRTEV
    VKTFRREKPFPYRRDCVTTTVENEDLFYCKWGGNWTCVKGEPVTYTGGPVKQCRWCGFDFNEPDGLPHYP
    IGKCILANETGYRIVDSTDCNRDGVVISTEGSHECLIGNTTVKVHALDERLGPMPCRPKEIVSSAGPVRK
    TSCTFNYAKTLRNRYYEPRDSYFQQYMLKGEYQYWFDLDVTDRHSDYFAEFIVLVVVALLGGRYVLWLIV
    TYIVLTEQLAAGLQLGQGEVVLIGNLITHTDIEVVVYFLLLYLVMRDEPIKKWILLLFHAMTNNPVKTIT
    VALLMVSGVAKGGKIDGGWQRLPETNFDIQLALTVIVVAVMLLAKKDPTTVPLVITVATLRTAKITNGLS
    TDLAIATVSTALLTWTYISDYYKYKTLLQYLISTVTGIFLIRVLKGVGELDLHTPTLPSYRPLFFILVYL
    ISTAVVTRWNLDIAGLLLQCVPTLLMVFTMWADILTLILILPTYELTKLYYLKEVKIGAERGWLWKTNFK
    RVNDIYEVDQAGEGVYLFPSKQKTGTITGTMLPLIKAILISCISNKWQFIYLLYLIFEVSYYLHKKIIDE
    IAGGTNFISRLVAALIEANWAFDNEEVRGLKKFFLLSSRVKELIIKHKVRNEVMVHWFGDEEVYGMPKLV
    GLVKAATLSKNKHCILCTVCENREWRGETCPKCGRFGPPVTCGMTLADFEEKHYKRIFFREDQSEGPVRE
    EYAGYLQYRARGQLFLRNLPVLATKVKMLLVGNLGTEVGDLEHLGWVLRGPAVCKKVTEHEKCTTSIMDK
    LTAFFGVMPRGTTPRAPVRFPTSLLKIRRGLETGWAYTHQGGISSVDHVTCGKDLLVCDTMGRTRVVCQS
    NNKMTDESEYGVKTDSGCPEGARCYVFNREAVNISGTKGAMVHLQKTGGEFTCVTASGTPAFFDLKNLKG
    WSGLPIFEASSGRVVGRVKVGKNEDSKPTKLMSGIQTVSKSTTDLTEMVKKITTMNRGEFRQITLATGAG
    KTTELPRSVIEEIGRHKRVLVLIPLRAAAESVYQYMRQKHPSIAFNLRIGEMKEGDMATGITYASYGYFC
    QMPQPKLRAAMVEYSFIFLDEYHCSTPEQLAIMGKIHRFSENLRVVAMTATPAGTVTTTGQKHPIEEYIA
    PEVMKGEDLGPEYLDIAGLKIPVEEMKSNMLVFVPTRNMAVETAKKLKAKGYNSGYYYSGEDPSNLRVVT
    SQSPYVVVATNAIESGVTLPDLDVVVDTGLKCEKRIRLSPKMPFIVTGLKRMAVTIGEQAQRRGRVGRVK
    PGRYYRSQETPVGSKDYHYDLLQAQRYGIEDGINITKSFREMNYDWSLYEEDSLMITQLEILNNLLISEE
    LPMAVKNIMARTDHPEPIQLAYNSYETQVPVLFPKIKNGEVTDSYDNYTFLNARKLGDDVPPYVYATEDE
    DLAVELLGLDWPDPGNQGTVEAGRALKQVVGLSTAENALLVALFGYVGYQALSKRHIPVVTDIYSIEDHR
    LEDTTHLQYAPNAIKTEGKETELKELAQGDVQRCMEAMTNYARDGIQFMKSQALKVKETPTYKETMDTVA
    DYVKKFMEALADSKEDIIKYGLWGTHTALYKSIGARLGNETAFATLVVKWLAFGGESIADHVKQAATDLV
    VYYIINRPQFPGDTETQQEGRKFVASLLVSALATYTYKSWNYNNLSKIVEPALATLPYAATALKLFAPTR
    LESVVILSTAIYKTYLSIRRGKSDGLLGTGVSAAMEIMSQNPVSVGIAVMLGVGAVAAHNAIEASEQKRT
    LLMKVFVKNFLDQAATDELVKESPEKIIMALFEAVQTVGNPLRLVYHVYGVFYKGWEAKELAQRTAGRNL
    FTLIMFEAVELLGVDSEGKIRQLSSNYILELLYKFRDSIKSSVRQMAISWAPAPFSCDWTPTDDRIGLPQ
    DNFLRVETKCPCGYKMKAVKNCAGELRLLEEEGSFLCRNKFGRGSRNYRVTKYYDDNLSEIKPVIRMEGH
    VELYYKGATIKLDFNNSKTILATDKWEVDHSTLVRVLKRHTGAGYCGAYLGEKPNHKHLIERDCATITKD
    KVCFLKMKRGCAFTYDLSLHNLTRLIELVHKNNLEDKEIPAVTVTTWLAYTFVNEDIGTIKPAFGEKITP
    EMQEEITLQPAVLVDATDVTVTVVGETPTMTTGETPTTFTSSGPDPKGQQVLKLGVGEGQYPGTNPQRAS
    LHEAIQSADERPSVLILGSDKATSNRVKTVKNVKVYRGRDPLEVRDMMRRGKILVIALSRVDNALLKFVD
    YKGTFLTRETLEALSLGRPKKKNITKAEAQWLLRLEDQMEELPDWFAAGEPIFLEANIKHDRYHLVGDIA
    TIKEKAKQLGATDSTKISKEVGAKVYSMKLSNWVMQEENKQSNLTPLFEELLQQCPPGGQNKTAHMVSAY
    QLAQGNWMPTSCHVFMGTISARRTKTHPYEAYVKLRELVEEHKMKTLCPGSSLRNDNEWVIGKIKYQGNL
    RTKHMLNPGKVAEQLHREGHRHNVYNKTIGSVMTATGIRLEKLPVVRAQTDTTNFHQAIRDKIDKEENLQ
    TPGLHKKLMEVFNALKRPELESSYDAVEWEELERGINRKGAAGFFERKNIGEILDSEKIKVEEIIDNLKK
    GRNIKYYETAIPKNEKRDVNDDWTAGDFVDEKKPRVIQYPEAKTRLAITKVMYKWVKQKPVVIPGYEGKT
    PLFQIFDKVKKEWDQFQNPVAVSFDTKAWDTQVTTNDLELIKDIQKYYFKKKWHKFIDTLTMHMSEVPVI
    TADGEVYIRKGQRGSGQPDTSAGNSMLNVLTMVYAFCEATGVPYKSFDRVAKIHVCGDDGFLITERALGE
    KFASKGVQILYEAGKPQKITEGDKMKVAYQFADIEFCSHTPIQVRWSDNTSSYMPGRNTTTILAKMATRL
    DSSGERGTIAYEKAVAFSFLLMYSWNPLIRRICLLVLSTELQVKPGKSTTYYYEGDPISAYKEVIGHNLF
    DLKRTSFEKLAKLNLSMSVLGAWTRHTSKRLLQDCVNMGVKEGNWLVNADRLVSSKTGNRYVPGEGHTLQ
    GRHYEELALARKQINSFQGTDRYNLGPIVNMVLRRLRVMMMTLIGRGV
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An N269A/Q mutation in the E(rns) protein created an attenuated mutant in swine. This mutant was able to induce effective protection in swine against challenge with wild type CSFV (Sainz et al., 2008).
  • Related Vaccine(s): Classical swine fever virus E(rns) mutant vaccine
2. E0
  • Gene Name : E0
  • VO ID : VO_0010898
  • NCBI Protein GI : 115343287
  • Other Database IDs : CDD:294141
    CDD:238220
  • Taxonomy ID : 11096
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein E0
  • Protein pI : 7.85
  • Protein Weight : 25600.45
  • Protein Length : 313
  • Protein Note : Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf...; cl00208
  • Protein Sequence : Show Sequence
    >ABI94604.1 envelope glycoprotein E0, partial [Classical swine fever virus]
    ENITQWNLSDNGTNGIQRAMYLRGVNRSLHGIWPEKICKGVPTHLATDTELTEIRGMMDASERTNYTCCR
    LQRHEWNKHGWCNWYNVDPWIQLMNRTQANLTEGPSDKECAVTCRYDRNADVNVVTQARNRPTTLTGCRK
    GKNFSFAGTVIEGPCNFNVSVEDILYGDHECGSLLQDTALYLLDGMTNTIENARQGAARVTSWLGRQLST
    AGKKLERRSKTWFGAYALSPYC
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Swine vaccinated with VVR expressing E0 and/or E2 resisted a lethal challenge infection with CSFV. Glycoprotein E0 represents a second determinant for the induction of protective immunity against classical swine fever (König et al., 1995).
  • Related Vaccine(s): Classical swine fever virus vaccine VAC-E0 , rPFV-CSFV-E0
3. E1
  • Gene Name : E1
  • Sequence Strain (Species/Organism) : Classical swine fever virus - Brescia
  • NCBI Nucleotide GI : 325460
  • NCBI Protein GI : 325461
  • Protein Accession : AAA43843.1
  • Taxonomy ID : 11098
  • Gene Strand (Orientation) : ?
  • Protein Name : envelope glycoprotein E1
  • DNA Sequence : Show Sequence
    >gi|325460|gb|M31768.1|HCVCG3PE Classical swine fever virus - Brescia hog cholera virus protein precursor, gene, complete cds
    AGTTCATTCTCGTGTACATGATTGGACAAATCAAAATCTCAATTTGGTTCAGGGCCTCCCTCCAGCGACG
    GCCGAGCTGGGCTAGCCATGCCCACAGTAGGACTAGCAAACGGAGGGACTAGCCGTAGTGGCGAGCTCCC
    TGGGTGGTCTAAGTCCTGAGTACAGGACAGTCGTCAGTAGTTCGACGTGAGCAGAAGCCCACCTCGAGAT
    GCTATGTGGACGAGGGCATGCCCAAGACACACCTTAACCTAGCGGGGGTCGTTAGGGTGAAATCACACCA
    TGTGATGGGAGTACGACCTGATAGGGTGCTGCAGAGGCCCACTATTAGGCTAGTATAAAAATCTCTGCTG
    TACATGGCACATGGAGTTGAATCATTTTGAACTTTTATACAAAACAAACAAACAAAAACCAATGGGAGTG
    GAGGAACCGGTATACGATGTAACGGGGAGACCATTGTTTGGAGACCCAAGTGAGGTACACCCACAATCAA
    CATTGAAGCTACCACATGATAGGGGGAGAGGCAACATCAAAACAACACTGAAGAATCTACCTAGGAGAGG
    TGACTGCAGGAGTGGCAACCACCTAGGCCCGGTTAGTGGGATATATGTAAAGCCCGGCCCTGTCTTTTAT
    CAGGACTACATGGGCCCAGTCTATCATAGAGCCCCTCTGGAGTTTTTTGACGAAGCACAGTTCTGTGAGG
    TGACCAAAAGGATAGGTAGGGTGACAGGTAGTGACGGAAAGCTTTACCATATATACGTGTGCATCGATGG
    TTGCATCCTGCTGAAGCTAGCCAAGAGGGGCGAGCCAAGAACCCTGAAGTGGATTAGAAATCTCACCGAC
    TGTCCATTGTGGGTTACCAGTTGTTCTGATGATGGTGCAAGTGCAAGTAAAGAGAAGAAACCAGATAGGA
    TCAACAAGGGTAAATTAAAGATAGCCCCAAAAGAGCATGAGAAGGACAGCAGGACTAAGCCACCTGATGC
    TACGATTGTAGTGGAAGGAGTAAAATACCAGGTCAAAAAGAAAGGTAAAGTTAAGGGAAAGAATACCCAA
    GACGGCCTGTACCACAACAAGAATAAACCACCAGAATCTAGGAAGAAATTAGAAAAAGCCCTATTGGCAT
    GGGCAGTGATAGCAATTATGTTATACCAACCTGTTGCAGCCGAAAATATAACTCAATGGAACCTGAGAGA
    CAACGGTACCAATGGTATCCAGCACGCTATGTACCTTAGAGGAGTCAGCAGAAGCTTGCATGGGATCTGG
    CCAGAAAAAATATGCAAAGGAGTCCCCACCTACCTGGCCACAGACACGGAACTGAGAGAAATACAGGGAA
    TGATGGTAGCCAGCGAGGGGACAAACTATACGTGCTGTAAGTTACAGAGACATGAATGGAACAAACATGG
    ATGGTGTAACTGGTATAACATAGACCCCTGGATACAGTTAATGAATAGAACCCAAGCAAACTTGGCAGAA
    GGCCCTCCGAGCAAGGAGTGCGCCGTGACTTGCAGGTACGATAAAAATGCTGACATTAACGTGGTCACCC
    AGGCCAGAAACAGGCCAACCACCCTAACTGGCTGCAAGAAAGGGACCAATTTTTCTTTTGCGGGTACAGT
    TATAGAGGGCCCATGTAATTTCAACGTTTCTGTCGAGGATATCTTATATGGGGATCATGAGTGTGGCAGT
    CTACTCCAGGATACGGCTCTATACCTAGTAGATGGAATGACCAACACTATAGAGAGAGCCAGGCAGGGAG
    CCGCGAGGGTGACATCTTGGCTAGGGAGGCAACTCCGCATTGCCGGGAAGAGGTTGGAGGGCAGAAGCAA
    AACCTGGTTTGGTGCCTATGCCCTATCACCTTATTGTAATGTGACAACGAAAATAGGGTACATATGGTAC
    ACTAACAACTGTACCCCGGCTTGCCTCCCCAAAAATACAAAGATAATAGGCCCCGGTAAATTTGACACTA
    ACGCGGAAGACGGAAAGATTCTCCATGAGATGGGGGGCCACCTATCAGAATTTCTGCTGCTCTCTCTGGT
    CGTTCTGTCTGACTTCGCCCCTGAAACAGCCAGCGCGTTATACCTCATTTTGCACTACGTGATCCCTCAA
    TCCCATGAAGAACCTGAAGGCTGTGACACAAACCAGCTGAATTTAACAGTGGAACTCAGGACTGAAGACG
    TGATACCATCATCAGTCTGGAATGTTGGCAAATATGTGTGTGTTAGACCAGACTGGTGGCCATATGAAAC
    CAAGGTGGCTTTGTTATTTGAAGAGGCAGGACAGGTCGTAAAGTTAGCCTTGCGGGCACTGAGGGATTTA
    ACCAGGGTCTGGAATAGCGCATCAACCACGGCATTCCTCATCTGCTTGATAAAAGTATTAAGAGGACAGG
    TCGTGCAAGGTGTGATATGGCTGTTACTGGTAACTGGGGCACAAGGCCGGCTAGCCTGCAAGGAAGATCA
    CAGGTACGCTATATCAACAACCAATGAGATAGGGCTACATGGGGCCGAAGGTCTCACTACCACCTGGAAA
    GAATACAACCACAATTTGCAACTGGATGATGGGACCGTCAAGGCCATCTGCATGGCAGGTTCCTTTAAAG
    TCACAGCACTTAATGTGGTTAGTAGGAGGTATCTGGCATCATTACATAAGGACGCTTTACCCACTTCCGT
    GACATTCGAGCTCCTGTTCGACGGGACCAGCCCATTGACCGAGGAAATGGGAGATGACTTCGGGTTCGGA
    CTGTGTCCGTATGATACGAGCCCTGTAGTCAAGGGAAAATACAACACAACCTTGTTGAATGGTAGTGCAT
    TCTACCTAGTTTGCCCAATAGGGTGGACGGGTGTTATAGAGTGCACGGCAGTGAGCCCGACAACTCTGAG
    AACAGAAGTGGTAAAGACCTTCAGAAGAGAGAAACCCTTTCCGTACAGAAGGGATTGTGTGACCACTACA
    GTGGAAAATGAAGATCTATTCTACTGTAAATGGGGGGGCAATTGGACATGTGTGAAAGGTGAACCAGTGA
    CCTACACGGGGGGGCCAGTAAAACAATGCAGATGGTGTGGCTTCGACTTCAATGAGCCTGACGGACTCCC
    ACACTACCCCATAGGTAAGTGCATTTTGGCAAATGAGACAGGTTACAGAATAGTGGATTCAACGGACTGT
    AACAGAGATGGCGTTGTAATCAGCACAGAGGGGAGTCATGAGTGCTTGATTGGTAACACAACTGTCAAGG
    TGCATGCATTAGATGAAAGACTAGGCCCTATGCCATGCAGGCCTAAGGAGATCGTCTCTAGTGCGGGACC
    TGTAAGGAAAACTTCCTGTACATTCAACTACGCAAAAACTCTGAGGAACAGGTATTATGAGCCCAGGGAC
    AGCTATTTCCAACAATATATGCTCAAGGGCGAGTATCAGTACTGGTTTGATCTGGATGTGACCGACCGCC
    ACTCAGATTACTTCGCAGAATTCATTGTCTTGGTGGTGGTGGCACTGTTGGGAGGAAGATATGTCCTGTG
    GCTAATAGTGACCTACATAGTTCTAACAGAACAACTCGCCGCTGGTCTACAGTTAGGCCAGGGTGAGGTA
    GTGTTAATAGGGAACTTAATCACCCACACAGATATTGAGGTTGTAGTATATTTCTTACTGCTCTATTTGG
    TCATGAGAGATGAGCCTATAAAGAAATGGATACTACTGCTGTTCCATGCTATGACCAACAATCCAGTTAA
    GACCATAACAGTGGCACTGCTCATGGTTAGCGGGGTTGCCAAGGGTGGAAAGATAGATGGTGGTTGGCAG
    CGGCTGCCGGAGACCAACTTTGATATCCAACTCGCGCTGACAGTTATAGTAGTCGCTGTGATGTTGCTGG
    CAAAGAAAGATCCGACTACCGTCCCCTTGGTTATAACGGTGGCAACCCTGAGAACGGCTAAGATAACTAA
    TGGACTTAGTACAGATCTAGCCATAGCTACAGTGTCAACAGCTTTGCTAACCTGGACCTACATTAGTGAC
    TATTATAAATACAAGACCTTGCTACAGTACCTTATTAGCACAGTGACAGGTATCTTCTTGATAAGGGTAC
    TGAAGGGGGTAGGTGAGTTAGATTTACACACCCCAACCTTACCATCTTACAGACCCCTCTTCTTCATCCT
    CGTGTACCTCATTTCCACTGCAGTGGTAACAAGATGGAATCTGGACATAGCCGGATTGCTGCTGCAGTGT
    GTCCCAACCCTTTTAATGGTTTTCACGATGTGGGCAGACATCCTTACCCTGATCCTCATACTGCCTACTT
    ACGAGTTGACAAAACTATATTACCTCAAGGAAGTGAAGATTGGGGCAGAAAGGGGCTGGTTGTGGAAGAC
    CAACTTCAAGAGGGTAAATGACATATACGAAGTTGACCAAGCTGGTGAGGGGGTGTACCTTTTCCCATCA
    AAACAAAAGACAGGTACAATAACAGGTACTATGTTGCCACTGATCAAAGCCATACTCATAAGTTGCATCA
    GCAATAAGTGGCAATTTATATATCTATTGTACTTGATATTCGAAGTGTCTTACTACCTTCACAAGAAGAT
    CATAGATGAAATAGCAGGAGGGACCAACTTCATCTCGAGACTTGTAGCCGCTCTGATCGAAGCCAATTGG
    GCCTTTGACAACGAAGAAGTTAGAGGTTTAAAGAAGTTCTTCTTGCTGTCTAGTAGGGTTAAAGAACTGA
    TCATCAAACACAAAGTGAGGAATGAAGTGATGGTCCACTGGTTTGGCGACGAAGAGGTCTATGGGATGCC
    GAAGCTGGTTGGCTTAGTCAAGGCAGCAACACTGAGTAAAAATAAACATTGTATTTTGTGCACCGTCTGT
    GAAAACAGAGAGTGGAGAGGAGAAACCTGCCCAAAATGCGGCCGTTTTGGGCCACCAGTGACCTGTGGCA
    TGACCCTAGCCGACTTTGAAGAAAAACACTATAAGAGGATTTTCTTTAGAGAGGATCAATCAGAAGGGCC
    GGTTAGGGAGGAGTATGCAGGGTATCTGCAATATAGAGCCAGAGGGCAATTATTCCTGAGGAATCTCCCG
    GTGCTAGCAACAAAAGTCAAGATGCTCCTGGTCGGAAATCTTGGGACGGAGGTGGGGGATTTGGAACACC
    TTGGCTGGGTGCTCAGAGGGCCTGCCGTTTGCAAGAAGGTTACCGAACATGAGAAATGCACCACATCCAT
    AATGGACAAATTAACTGCTTTCTTCGGTGTTATGCCAAGGGGCACCACACCTAGAGCCCCTGTGAGATTC
    CCCACCTCTCTCTTAAAGATAAGAAGGGGGCTGGAAACTGGCTGGGCGTACACACACCAAGGTGGCATCA
    GTTCAGTGGACCATGTCACTTGTGGGAAAGACTTACTGGTATGTGACACTATGGGCCGGACAAGGGTTGT
    TTGCCAATCAAATAACAAGATGACAGACGAGTCCGAGTATGGAGTTAAAACTGACTCCGGATGCCCGGAG
    GGAGCTAGGTGTTACGTGTTCAACCGAGAGGCAGTTAATATATCCGGGACTAAAGGAGCTATGGTCCACT
    TACAAAAAACTGGAGGAGAATTCACCTGTGTGACAGCATCAGGGACTCCGGCCTTCTTTGATCTCAAGAA
    CCTCAAAGGCTGGTCAGGGCTACCGATATTTGAGGCATCAAGTGGAAGAGTAGTCGGCAGGGTTAAGGTC
    GGGAAGAATGAGGACTCTAAACCAACCAAGCTTATGAGTGGAATACAAACAGTCTCCAAAAGTACCACAG
    ACTTGACAGAAATGGTAAAGAAAATAACAACCATGAACAGGGGAGAATTCAGACAAATAACCCTTGCCAC
    AGGTGCCGGAAAAACCACGGAACTCCCTAGATCAGTCATAGAAGAGATAGGAAGGCATAAGAGGGTCTTG
    GTCTTGATCCCTCTGAGGGCGGCAGCAGAGTCAGTATACCAATATATGAGACAAAAACACCCAAGCATAG
    CATTCAACTTGAGGATAGGGGAGATGAAGGAAGGGGACATGGCCACAGGGATAACCTATGCCTCATATGG
    TTACTTCTGTCAGATGCCACAACCTAAGCTGCGAGCCGCGATGGTTGAGTACTCCTTCATATTCCTTGAT
    GAGTACCACTGTTCCACCCCCGAACAATTGGCTATCATGGGAAAGATCCACAGATTTTCAGAGAACCTGC
    GGGTAGTAGCCATGACCGCAACACCAGCAGGCACGGTAACAACTACAGGGCAAAAACACCCTATAGAAGA
    ATACATAGCCCCAGAAGTGATGAAGGGGGAAGACTTAGGTCCAGAGTACTTGGACATAGCTGGACTAAAG
    ATACCAGTAGAGGAGATGAAGAGTAACATGCTGGTCTTTGTGCCCACAAGGAACATGGCTGTAGAGACGG
    CAAAGAAACTGAAAGCTAAGGGTTATAACTCAGGCTACTATTATAGTGGAGAGGATCCATCTAACCTGAG
    GGTGGTAACATCACAGTCCCCGTACGTGGTGGTAGCAACCAACGCAATAGAATCAGGTGTTACTCTCCCA
    GACTTGGATGTGGTCGTCGACACAGGGCTTAAGTGTGAAAAGAGGATACGGCTGTCACCTAAGATGCCCT
    TCATAGTGACGGGCCTGAAGAGAATGGCTGTCACGATTGGGGAACAAGCCCAGAGAAGGGGGAGAGTTGG
    GAGAGTGAAGCCTGGGAGATACTACAGGAGTCAAGAAACCCCCGTTGGTTCCAAAGATTACCATTACGAC
    CTACTGCAAGCACAGAGGTACGGTATAGAAGATGGGATAAACATCACCAAATCTTTTAGAGAGATGAATT
    ATGATTGGAGCCTTTATGAGGAGGATAGTCTGATGATTACACAATTGGAAATCCTCAACAATCTGTTGAT
    ATCAGAAGAGCTACCAATGGCAGTAAAAAATATAATGGCCAGGACTGACCACCCAGAACCAATCCAACTG
    GCGTACAACAGCTACGAAACGCAGGTGCCAGTTCTATTCCCAAAAATAAAAAATGGAGAGGTGACTGACA
    GTTACGATAACTATACCTTCCTCAACGCAAGAAAGCTGGGGGATGATGTACCACCCTACGTGTATGCCAC
    AGAGGATGAGGACTTAGCGGTAGAGCTGCTGGGCTTAGACTGGCCGGACCCTGGGAACCAAGGAACCGTG
    GAGGCTGGTAGAGCACTAAAACAAGTAGTTGGTCTATCAACAGCTGAGAACGCCCTGTTAGTAGCTTTAT
    TCGGCTATGTAGGATATCAGGCACTCTCAAAGAGGCATATACCAGTAGTCACAGACATATATTCAATTGA
    AGATCACAGGTTGGAAGACACCACACACCTACAGTATGCCCCGAATGCTATCAAGACGGAGGGGAAGGAG
    ACAGAATTGAAGGAGCTAGCTCAGGGGGATGTGCAGAGATGTATGGAAGCTATGACTAATTATGCAAGAG
    ATGGCATCCAATTCATGAAGTCTCAGGCACTGAAAGTGAAAGAAACCCCCACTTACAAAGAGACAATGGA
    CACCGTGGCGGACTATGTAAAGAAGTTCATGGAGGCACTGGCGGACAGCAAAGAAGACATCATAAAATAT
    GGGTTGTGGGGGACGCACACAGCCTTATATAAGAGCATCGGTGCTAGGCTTGGGAACGAGACTGCGTTCG
    CTACCCTGGTCGTGAAATGGCTGGCATTTGGGGGAGAATCAATAGCAGACCATGTCAAACAAGCGGCCAC
    AGACTTGGTCGTTTACTATATCATCAACAGACCTCAGTTCCCAGGAGACACGGAGACACAACAGGAAGGA
    AGGAAATTTGTAGCCAGCCTACTGGTCTCAGCCCTGGCTACTTACACTTACAAAAGCTGGAATTACAATA
    ATCTGTCCAAGATAGTTGAACCGGCTTTGGCTACTCTGCCCTATGCCGCCACAGCTCTCAAGCTATTCGC
    CCCCACTCGATTGGAGAGCGTTGTCATACTGAGTACCGCAATCTACAAAACCTACCTATCAATCAGGCGC
    GGAAAAAGCGATGGTTTGCTAGGCACAGGGGTTAGTGCGGCTATGGAAATCATGTCACAAAACCCAGTAT
    CTGTGGGTATAGCGGTCATGCTAGGGGTGGGGGCCGTAGCGGCCCACAATGCAATCGAAGCCAGTGAGCA
    GAAGAGAACACTACTCATGAAAGTTTTTGTAAAGAACTTCTTGGATCAGGCAGCCACTGATGAATTAGTC
    AAGGAGAGCCCTGAGAAAATAATAATGGCTTTGTTTGAAGCAGTGCAGACAGTCGGCAACCCTCTTAGAC
    TGGTATACCACGTTTACGGAGTTTTTTACAAAGGGTGGGAGGCAAAAGAGTTGGCCCAAAGGACAGCCGG
    TAGGAATCTTTTCACTTTGATAATGTTTGAGGCTGTGGAACTACTGGGAGTAGATAGCGAAGGAAAGATC
    CGCCAGCTATCAAGCAATTACATACTAGAGCTCCTGTATAAGTTCCGTGACAGTATCAAGTCCAGCGTGA
    GGCAGATGGCAATCAGCTGGGCCCCTGCCCCTTTTAGTTGTGATTGGACACCGACGGATGACAGAATAGG
    GCTTCCCCAAGATAATTTCCTCCGAGTGGAGACAAAATGCCCCTGTGGTTACAAGATGAAAGCAGTTAAG
    AATTGTGCTGGGGAGTTGAGACTCTTAGAGGAGGAAGGCTCATTTCTCTGCAGGAATAAATTCGGGAGAG
    GTTCACGGAACTACAGGGTGACAAAATACTATGATGACAATCTATCAGAAATAAAGCCAGTGATAAGAAT
    GGAAGGACATGTGGAACTCTACTACAAGGGAGCCACTATTAAACTGGATTTCAACAACAGTAAAACAATA
    TTGGCAACCGATAAATGGGAGGTCGATCACTCCACTCTGGTCAGGGTGCTCAAGAGGCACACAGGGGCTG
    GATATTGTGGGGCATACCTGGGTGAGAAACCGAACCACAAACATCTGATAGAGAGGGACTGCGCAACCAT
    CACCAAAGATAAGGTTTGTTTTCTCAAGATGAAGAGAGGGTGTGCATTTACTTATGACTTATCCCTTCAC
    AACCTTACCCGGCTGATTGAATTGGTACACAAGAATAACTTGGAAGACAAAGAGATTCCTGCCGTTACGG
    TCACAACCTGGCTGGCTTACACATTTGTAAATGAAGATATAGGGACCATAAAACCAGCCTTCGGGGAGAA
    AATAACACCAGAGATGCAGGAGGAGATAACCTTGCAGCCTGCTGTATTGGTGGATGCAACTGACGTGACC
    GTGACCGTGGTAGGGGAAACCCCTACTATGACTACAGGGGAGACCCCAACAACGTTCACCAGCTCAGGTC
    CAGACCCGAAAGGCCAACAAGTTTTAAAACTGGGTGTAGGTGAAGGCCAATACCCCGGGACTAATCCACA
    GAGAGCAAGCCTGCACGAAGCCATACAAAGCGCAGATGAAAGGCCCTCTGTGCTGATATTGGGGTCTGAT
    AAAGCCACCTCTAATAGAGTGAAAACTGTAAAGAATGTGAAGGTATACAGAGGCAGGGACCCACTAGAAG
    TGAGAGATATGATGAGGAGGGGAAAGATCCTAGTCATAGCCCTGTCTAGGGTTGATAATGCTCTATTGAA
    ATTTGTAGATTACAAAGGCACCTTTTTAACTAGAGAGACCCTGGAGGCATTAAGTTTGGGTAGGCCAAAA
    AAGAAAAACATAACCAAGGCAGAAGCACAGTGGTTGCTGCGCCTCGAAGACCAAATGGAAGAGCTACCCG
    ATTGGTTCGCAGCCGGGGAACCCATTTTTCTAGAGGCCAATATTAAACATGACAGGTATCATCTGGTAGG
    GGATATAGCTACTATCAAAGAGAAAGCCAAACAATTGGGGGCTACAGACTCTACAAAGATATCCAAGGAG
    GTTGGTGCAAAAGTATATTCTATGAAATTGAGTAATTGGGTGATGCAAGAAGAAAACAAACAGAGCAACT
    TGACCCCCTTATTTGAAGAGCTCCTACAGCAGTGTCCACCCGGAGGCCAAAACAAAACTGCACATATGGT
    CTCTGCTTACCAACTAGCTCAAGGGAACTGGATGCCAACCAGCTGCCATGTTTTTATGGGGACCATATCT
    GCCAGAAGGACTAAGACCCATCCATATGAAGCATATGTCAAGTTAAGGGAGTTGGTAGAGGAACACAAGA
    TGAAAACATTGTGTCCCGGATCAAGTCTGCGTAACGACAATGAATGGGTAATTGGCAAGATCAAATACCA
    GGGCAACCTGAGGACCAAACACATGTTGAACCCCGGCAAGGTGGCAGAGCAACTGCACAGAGAAGGACAC
    AGACACAATGTGTATAACAAGACAATAGGCTCAGTGATGACAGCTACTGGCATCAGGTTGGAGAAGTTGC
    CCGTGGTTAGGGCCCAGACAGACACAACCAACTTCCACCAAGCAATAAGGGATAAGATAGACAAGGAAGA
    GAATCTACAGACCCCGGGTTTACATAAGAAACTAATGGAAGTTTTCAATGCATTGAAACGACCCGAGTTA
    GAGTCCTCCTATGACGCTGTGGAATGGGAGGAATTGGAGAGAGGAATAAACAGAAAGGGTGCTGCTGGTT
    TCTTTGAACGCAAAAACATAGGGGAGATATTGGATTCAGAGAAAATTAAAGTAGAAGAGATTATTGACAA
    TCTGAAAAAGGGTAGAAATATCAAATACTATGAAACCGCAATCCCAAAAAATGAAAAGAGGGATGTCAAT
    GATGACTGGACCGCAGGTGACTTTGTGGACGAGAAGAAACCCAGAGTCATACAATACCCTGAAGCAAAAA
    CAAGGCTGGCCATCACCAAGGTGATGTATAAGTGGGTGAAGCAGAAGCCAGTAGTCATACCCGGGTATGA
    AGGGAAGACACCTCTGTTCCAAATTTTTGACAAAGTAAAGAAGGAATGGGATCAATTCCAAAATCCAGTG
    GCAGTGAGCTTCGACACTAAGGCGTGGGACACCCAGGTGACCACAAATGATCTGGAGCTGATAAAGGACA
    TACAAAAGTACTACTTCAAGAAGAAATGGCATAAATTTATTGACACCCTGACTATGCATATGTCAGAAGT
    ACCCGTAATCACTGCTGATGGGGAGGTGTATATAAGGAAAGGGCAAAGAGGTAGTGGACAGCCCGACACA
    AGCGCAGGCAACAGCATGCTAAATGTGTTAACAATGGTTTATGCCTTCTGCGAGGCCACAGGGGTACCCT
    ACAAGAGTTTTGACAGGGTGGCAAAAATTCATGTGTGTGGGGACGATGGTTTCCTGATCACAGAGAGAGC
    TCTCGGCGAGAAATTCGCAAGCAAGGGAGTCCAAATCCTGTATGAAGCTGGGAAGCCCCAGAAGATCACT
    GAAGGGGACAAAATGAAAGTGGCCTACCAATTTGCTGATATTGAGTTTTGCTCCCATACACCAATACAAG
    TAAGGTGGTCAGATAACACTTCTAGCTACATGCCAGGGAGAAATACAACCACAATCCTGGCTAAAATGGC
    CACAAGGTTAGATTCCAGTGGTGAGAGGGGTACCATAGCGTACGAGAAAGCAGTAGCATTCAGCTTCCTG
    CTAATGTATTCCTGGAACCCACTAATCAGAAGGATTTGCTTATTGGTACTATCAACTGAACTGCAAGTGA
    AACCAGGGAAGTCAACCACTTACTATTATGAAGGGGACCCGATATCTGCCTACAAGGAAGTCATCGGCCA
    CAATCTTTTCGATCTCAAGAGAACAAGCTTCGAGAAGCTGGCCAAGTTAAATCTCAGCATGTCCGTACTC
    GGGGCCTGGACTAGACACACCAGCAAAAGACTACTACAAGACTGTGTCAATATGGGTGTTAAAGAGGGCA
    ACTGGTTAGTCAATGCAGACAGACTGGTGAGTAGTAAGACTGGAAATAGGTATGTACCTGGAGAAGGCCA
    CACCCTGCAAGGGAGACATTATGAAGAACTGGCGTTGGCAAGAAAACAGATCAACAGCTTCCAAGGGACA
    GACAGGTACAATCTAGGCCCAATAGTCAACATGGTGTTAAGGAGGCTGAGAGTCATGATGATGACCCTGA
    TAGGGAGAGGGGTATGAGTGCGGGTGACCCGCGATCTGGACCCGTCAGTAGGACCCTATTGTAGATAACA
    CTAATTTTTTATTTATTTAGATATTACTATTTATTTATTTATTTATTTATTGAATGAGTAAGAACTGGTA
    CAAACTACCTCATGTTACCACACTACACTCATTTTAACAGCACTTTAGCTGGAAGGAAAATTCCTGACGT
    CCACAGTTGGACTAAGGTAATTTCTAACGGCCC
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An N to A amino acid substitution was made in the N594 site of the E1 glycoprotein, resulting in attenuation of the virus in swine. This attenuated virus induced protection against challenge with wild type CSFV (Fernandez-Sainz et al., 2009).
  • Related Vaccine(s): Classical swine fever virus E1 mutant vaccine
4. E2
  • Gene Name : E2
  • Sequence Strain (Species/Organism) : Classical swine fever virus strain LPC
  • VO ID : VO_0010897
  • NCBI Protein GI : 50403916
  • Other Database IDs : CDD:292945
  • Taxonomy ID : 11096
  • Gene Starting Position : 373
  • Gene Ending Position : 12069
  • Gene Strand (Orientation) : +
  • Protein Name : E2 protein
  • Protein pI : 8.23
  • Protein Weight : 6837.14
  • Protein Length : 127
  • Protein Note : Pestivirus envelope glycoprotein E2; pfam16329
  • Protein Sequence : Show Sequence
    >AAT76713.1 E2 protein, partial [Classical swine fever virus]
    TTTWKEYTHDLQLNDGTVKATCVAGSFKVTALNVVSRRYLASLHKKALPTSVTFELLFDGTNP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Pigs were subjected to challenge infection with a dose of 1x10(5)TCID(50) (50% tissue culture infective dose) virulent CSFV strain. At 1 week post challenge infection, all of the yE2-immunized pigs were alive and without symptoms or signs of CSF. The yeast-expressed E2 protein retains correct immunogenicity and is able to induce a protective immune response against CSFV infection (Lin et al., 2009).

    In a seperate study, swine vaccinated with VVR expressing E0 and/or E2 resisted a lethal challenge infection with CSFV. Glycoprotein E0 represents a second determinant for the induction of protective immunity against classical swine fever (König et al., 1995).
  • Related Vaccine(s): Classical swine fever virus vaccine VAC-E2 , rAdV-SFV-E2
5. E2
  • Gene Name : E2
  • Sequence Strain (Species/Organism) : Classical swine fever virus
  • NCBI Gene ID : 920146
  • NCBI Protein GI : 12657942
  • Locus Tag : PestiV2gp1
  • Genbank Accession : AF326963
  • Protein Accession : NP_075354
  • Taxonomy ID : 11096
  • Gene Starting Position : 373
  • Gene Ending Position : 12069
  • Gene Strand (Orientation) : +
  • Protein Name : polyprotein
  • Protein pI : 8.53
  • Protein Weight : 408166.02
  • Protein Length : 3898
  • DNA Sequence : Show Sequence
    >NC_002657.1:373-12069 Classical swine fever virus, complete genome
    CATGGAGTTGAATCATTTTGAACTTTTATACAAAACAAACAAACAAAAACCAATGGGAGTGGAGGAACCG
    GTATACGATGCCACGGGGAGGCCATTGTTTGGAGACCCGAGTGAGGTACACCCACAATCAACACTGAAGC
    TACCACATGATAGGGGGAGAGGTAACATCAAAACAACACTGAAGAACCTACCTAGGAAAGGCGACTGCAG
    GAGTGGCAACCATCTAGGCCCGGTTAGTGGGATATATGTAAAGCCCGGCCCTGTCTTTTATCAGGACTAC
    ATGGGCCCGGTCTACCATAGAGCCCCTCTAGAGTTTTTTAACGAAGCGCAGTTTTGCGAGGTGACCAAAA
    GGATAGGTAGGGTGACAGGTAGTGACGGAAAGCTTTACCATATATATGTGTGCATCGATGGTTGCATACT
    GCTGAAGCTAGCCAAGAGGGACGAGCCAAGAACCCTGAAGTGGATTAGAAATTTCACCGACTGTCCATTG
    TGGGTTACCAGTTGCTCTGATGATGGCGCAAGTGGAAGTAAAGAGAAGAAGCCAGATAGGATCAACAAAG
    GCAAATTAAAAATAGCCCCAAAAGAGCATGAGAAGGACAGCAGAACTAAGCCACCTGACGCTACGATTGT
    AGTGGAAGGAGTAAAATACCAGGTTAAAAAGAAGGGTAAAGTTAAAGGAAAGAGTACCCAAGACGGCCTG
    TACCACAACAAGAATAAACCACCAGAATCTAGGAAGAAATTAGAAAAAGCCCTATTGGCATGGGCGGTAA
    TAGCAATTATGTTGTACCAACCAGTTGAAGCCGAAAATATAACTCAATGGAACCTGAGTGACAACGGCAC
    TAATGGTATCCAGCATGCTATGTACCTTAGAGGGGTTAGCAGGAGCTTGCATGGGATCTGGCCGGAAAAA
    ATATGCAAAGGAGTCCCCACCTACCTGGCCACAGACACGGAACTGAAAGAAATACAGGGAATGATGGATG
    CCAGCGAGGGGACAAACTATACGTGCTGTAAGTTACAGAGACATGAATGGAACAAACATGGATGGTGTAA
    CTGGTACAATATAGACCCCTGGATACAGTTGATGAATAGAACCCAAGCAAACTTGGCAGAAGGCCCTCCG
    GCCAAGGAGTGCGCTGTGACTTGCAGGTACGATAAAGATGCTGACATCAACGTGGTCACCCAGGCCAGAA
    ACAGGCCAACAACCCTGACCGGTTGCAAGAAAGGAAAAAATTTTTCTTTTGCGGGTACAGTTATAGAGGG
    CCCATGTAATTTCAATGTTTCCGTGGAGGATATCTTGTATGGGGATCATGAGTGCGGCAGTTTGCTTCAG
    GACACGGCTCTGTACCTAGTGGATGGAATGACCAACACTATAGAGAATGCCAGACAGGGAGCAGCGAGGG
    TAACATCTTGGCTCGGGAGGCAACTCAGCACTGCCGGGAAGAGGTTGGAGGGTAGAAGCAAAACCTGGTT
    TGGTGCCTATGCCCTATCGCCTTACTGTAATGTAACAAGCAAAATAGGGTACATATGGTACACTAACAAC
    TGCACCCCGGCTTGCCTCCCCAAAAATACAAAGATAATAGGCCCCGGAAAATTTGACACTAACGCGGAAG
    ACGGAAAGATTCTCCATGAGATGGGGGGTCACCTATCAGAATTTCTGCTGCTCTCTCTGGTTGTTCTGTC
    TGACTTCGCCCCTGAAACAGCCAGCGCGTTATACCTCATTTTGCACTACATGATTCCTCAATCCCATGAA
    GAACCTGAAGGCTGCGACACAAACCAGCTGAATCTAACAGTGGAACTCAGGACTGAAGACGTAATACCGT
    CATCAGTCTGGAATGTTGGCAAATATGTGTGTGTTAGACCAGACTGGTGGCCATATGAAACCAAGGTGGC
    TTTGTTATTTGAAGAGGCAGGACAGGTCGTAAAATTAGCCTTACGAGCGCTGAGGGATTTAACCAGGGTC
    TGGAATAGCGCATCAACCACGGCATTCCTCATCTGCTTGATAAAAGTATTAAGAGGACAGATCGTGCAAG
    GTGTGATATGGCTGCTACTAGTAACTGGGGCACAAGGCCGGCTAGCCTGCAAGGAAGATTACAGGTACGC
    AATATCATCGACCAATGAGATAGGGCTACTCGGGGCCGAAGGTCTCACCACCACCTGGAAAGAATACAAC
    CACGATTTGCAACTGAATGACGGGACCGTTAAGGCCATTTGCGTGGCAGGTTCCTTTAAAGTCATAGCAC
    TTAATGTGGTCAGTAGGAGGTATTTGGCATCATTGCATAAGGAGGCTTCACTCACTTCCGTGACATTTGA
    GCTCCTGTTCGACGGGACCAACCCATCAACTGAGGAAATGGGAGATGACTTCGGGTTCGGGCTGTGCCCG
    TTCGATACGAGTCCTGTTGTCAAGGGAAAGTACAATACAACCTTGTTGAACGGTAGTGCTTTCTATCTTG
    TCTGCCCAATAGGGTGGACGGGTGTCATAGAGTGCACAGCAGTGAGCCCAACAACTCTGAGAACAGAAGT
    GGTAAAGACCTTCAGGAGAGACAAGCCCTTTCCGCACAGAATGGATTGTGCGACCACCACAGTGGAAAAT
    GGAGATTTATTCTACTGTAAGTTGGGGGGCAACTGGACATGTGTGAAAGGTGAACCAGTGGTCTACACGG
    GGGGGCTAGTAAAACAATGCAGATGGTGTGGCTTCGACTTCAATGAGCCCGACGGACTCCCGCACTACCC
    CATAGGTAAGTGCATCTTGGTAAATGAGACAGGTTACAGAATAGTAGATTCAACGGACTGTAACAGAGAT
    GGCGTTGTAATCAGCACAGATGGGAGTCATGAGTGCTTGATCGGTAACACAACTGTCAAGGTGCATGCAT
    CAGATGAAAGACTGGGCCCTATGCCATGCAGACCCAAAGAGATTGTCTCTAGTGCAGGACCTGTAAGGAA
    AACTTCCTGTACATTCAACTACGCAAAAACTTTGAAGAACAAGTACTATGAGCCCAGGGACAGCTACTTC
    CAGCAATATATGCTTAAGGGCGAGTATCAGTACTGGTTTGACCTGGACGTGACTGACCGCCACTCAGATT
    ACTTCGCAGAATTTGTCGTCTTGGTAGTGGTAGCACTGTTAGGAGGAAGATATGTCCTGTGGCTAATAGT
    GACCTACATAGTTCTAACAGAACAACTCGCCGCTGGTTTACCATTGGGCCAGGGTGAGGTAGTGTTGATA
    GGGAACTTAATTACCCACACAGACATTGAGGTCGTAGTATATTTCTTACTACTCTATTTGGTCATGAGGG
    ATGAGCCTATAAAGAAATGGATACTGCTGCTGTTCCATGCTATGACTAACAATCCAGTCAAGACCATAAC
    AGTGGCATTGCTTATGGTTAGTGGGGTTGCCAAGGGTGGAAAGATAGACGGCGGTTGGCAGCGGCTGCCA
    GAGACCAGCTTTGACATCCAACTCGCGCTGACAGTTATAGTAGTCGCTGTGATGTTACTGGCAAAGAGAG
    ATCCAACTACTGTCCCCTTGGTTATAACAGTGGCAACCCTGAGAACGGCTAAGATGACTAATGGACTTAG
    CACGGATATAGCCATAGCTACAGTGTCAACAGCGTTGCTAACCTGGACCTACATTAGTGACTATTATAGA
    TACAAGACTTGGCTACAGTACCTTATTAGCACAGTGACAGGTATCTTCTTAATAAGGGTACTGAAGGGAA
    TAGGTGAGTTGGATTTACACACTCCAACCTTGCCATCTTACAGACCCCTCTTCTTCATTCTCGTGTACCT
    CATTTCCACTGCAGTGGTAACAAGATGGAATCTGGACATAGCCGGATTGCTGTTGCAGTGTGTCCCAACC
    CTTTTGATGGTTTTTACGATGTGGGCAGACATTCTCACCCTGATCCTCATACTGCCCACTTACGAGCTAA
    CAAAACTATATTACCTCAAGGAAGTGAAGACTGGGGCAGAAAAGGGCTGGTTATGGAAGACCAACTTCAA
    GAGGGTAAACGACATATACGAAGTTGACCAATCTGGTGAAGGGGTTTACCTTTTCCCGTCAAAACAAAAG
    ACAAGTTCAATAACAGGTACCATGTTGCCATTGATCAAAGCCATACTCATCAGCTGCATCAGTAATAAGT
    GGCAGTTCATATATCTATTGTACTTGATATTTGAAGTGTCTTACTACCTCCACAAGAAGATCATAGATGA
    AATAGCAGGAGGGACCAACTTCATCTCAAGACTTGTAGCCGCTTTGATCGAAGCCAATTGGGCCTTTGAC
    AACGAAGAAGTTAGGGGTTTAAAGAAGTTCTTCCTGTTGTCTAGTAGGGTTAAAGAACTGATCATCAAAC
    ACAAAGTGAGGAATGAAGTAATGGTCCACTGGTTTGGTGACGAAGAGGTTTATGGGATGCCAAAGTTGGT
    TGGCTTAGTCAAGGCAGCAACATTGAGTAAAAATAAACATTGTATTTTGTGCACCGTCTGTGAAGACAGA
    GAGTGGAGAGGAGAAACCTGCCCAAAATGCGGGCGTTTTGGGCCACCAATGACCTGTGGTATGACCCTAG
    CCGACTTTGAAGAAAAACATTATAAGAGGATCTTTTTTAGAGAGGATCAATCAGAAGGGCCGGTTAGAGA
    GGAGTACGCAGGGTATCTGCAATATAGAGCCAGAGGGCAATTATTCCTGAGGAATCTCCCGGTGCTAGCA
    ACAAAAGTCAAGATGCTCCTGGTCGGAAATCTTGGGACGGAGGTGGGAGACTTGGAACACCTTGGCTGGG
    TCCTTAGGGGGCCTGCCGTTTGCAAGAAGGTTACCGAACATGAGAAATGCACCACATCCATAATGGACAA
    ATTGACTGCTTTTTTCGGTGTTATGCCAAGGGGCACCACACCTAGAGCCCCTGTGAGATTCCCCACCTCT
    CTCTTAAAGATAAGAAGGGGGTTGGAAACTGGCTGGGCGTACACACACCAAGGTGGCATTAGTTCAGTGG
    ACCATGTCACTTGTGGGAAAGACTTGCTGGTATGTGACACTATGGGCCGGACAAGGGTCGTTTGCCAATC
    AAATAATAAGATGACAGATGAGTCTGAGTATGGAGTTAAAACTGACTCCGGATGCCCGGAAGGAGCTAGG
    TGTTATGTGTTCAACCCAGAGGCAGTTAACATATCAGGGACTAAAGGAGCCATGGTCCACTTACAAAAAA
    CTGGAGGAGAATTCACCTGTGTGACAGCATCAGGAACTCCGGCCTTCTTTGATCTCAAGAACCTCAAAGG
    CTGGTCAGGGCTACCGATATTTGAGGCATCAAGTGGAAGGGTAGTCGGCAGGGTCAAGGTCGGGAAGAAT
    GAGGACTCTAAACCAACCAAGCTTATGAGTGGAATACAAACAGTCTCCAAAAGTACCACAGACTTGACAG
    AAATGGTAAAGAAAATAACGACCATGAACAGGGGAGAATTCAGACAAATAACCCTTGCTACAGGTGCCGG
    AAAAACCACGGAACTCCCTAGGTCAGTCATAGAAGAGATAGGGAGGCATAAGAGAGTCTTGGTCTTGATC
    CCTCTGAGGGCGGCAGCAGAGTCAGTATACCAATATATGAGACAAAAACATCCAAGCATCGCATTTAACC
    TGAGGATAGGGGAGATGAAGGAAGGGGACATGGCCACAGGGATAACCTATGCTTCATACGGTTACTTCTG
    TCAGATGCCACAACCTAAGTTGCGAGCCGCGATGGTTGAGTACTCCTTCATATTTCTTGACGAGTACCAC
    TGTGCCACCCCAGAACAATTGGCCATCATGGGAAAGATCCACAGATTTTCAGAGAACCTGCGGGTAGTAG
    CCATGACCGCAACACCAGCAGGCACAGTAACAACCACAGGGCAGAAACACCCTATAGAAGAATTCATAGC
    CCCAGAAGTGATGAAAGGGGAAGACTTAGGCTCAGAGTACTTGGACATTGCTGGACTAAAGATACCAGTA
    GAGGAGATGAAGAGCAACATGCTGGTTTTTGTGCCCACTAGGAACATGGCGGTGGAGACAGCAAAGAAAT
    TGAAAGCTAAGGGTTACAACTCAGGCTACTATTATAGTGGAGAGGATCCATCTAACCTGAGGGTGGTAAC
    GTCGCAGTCCCCGTACGTGGTGGTGGCAACCAACGCGATAGAATCAGGTGTTACTCTCCCGGACTTGGAT
    GTGGTTGTCGATACAGGGCTTAAGTGTGAAAAGAGAATACGGCTGTCACCTAAGATGCCCTTCATAGTGA
    CGGGCCTGAAGAGAATGGCTGTCACGATTGGGGAACAAGCCCAGAGAAGGGGGAGAGTTGGGAGAGTAAA
    GCCTGGGAGATACTACAGGAGTCAAGAAACTCCCGTTGGTTCTAAAGATTACCATTATGATCTACTGCAA
    GCACAGAGGTACGGTATTGAAGATGGGATAAACATCACCAAATCCTTTAGAGAGATGAACTATGATTGGA
    GCCTTTATGAGGAGGACAGTCTGATGATTACACAATTGGAAATCCTCAATAATTTGTTGATATCAGAAGA
    ACTACCGATGGCAGTAAAAAATATAATGGCCAGGACTGACCACCCAGAACCAATTCAGCTGGCGTACAAC
    AGCTACGAAACACAAGTGCCAGTGCTATTCCCAAAAATAAAGAATGGAGAGGTGACTGATAGTTACGATA
    ACTATACCTTCCTCAACGCAAGAAAATTGGGGGATGATGTACCCCCTTACGTGTATGCCACAGAGGATGA
    GGACTTAGCGGTAGAGCTACTGGGCTTAGACTGGCCAGACCCTGGAAACCAAGGAACCGTAGAGGCTGGC
    AGAGCACTAAAACAAGTAGTTGGTCTATCAACAGCTGAGAATGCCCTGTTAGTAGCCTTATTCGGCTATG
    TAGGATATCAGGCACTTTCAAAGAGGCATATACCAGTAGTCACAGATATATATTCAATTGAAGATCACAG
    GTTGGAAGACACCACACACCTACAGTACGCCCCAAATGCTATCAAGACGGAGGGGAAGGAGACAGAATTG
    AAGGAGCTAGCCCAGGGGGATGTGCAGAGATGTGTGGAAGCTATGACCAATTATGCAAGAGAGGGTATCC
    AATTCATGAAGTCTCAGGCACTGAAGGTGAAAGAAACCCCCACTTACAAAGAGACAATGAACACTGTGAC
    TGACTATGTAAAGAAATTCATGGAGGCGCTGGCAGACAGTAAAGAAGACATCTTAAGATATGGGTTGTGG
    GGGACGCACACAGCCTTATATAAGAGCATCAGTGCCAGGCTTGGGAGTGAGACTGCGTTCGCTACCCTGG
    TCGTGAAGTGGCTGGCATTTGGGGGGGAATCAATAGCAGACCATGTCAAACAAGCGGCCACAGACTTGGT
    CGTCTACTATATCATCAACAGACCTCAGTTCCCAGGAGACACAGAGACACAACAGGAAGGAAGGAAATTT
    GTGGCCAGCCTACTGGTCTCAGCTCTAGCTACTTACACATACAAAAGCTGGAATTACAATAATCTGTCCA
    AGATAGTTGAACCGGCTTTGGCCACTCTGCCCTATGCCGCCACAGCTCTCAAACTATTCGCCCCCACTCG
    ATTGGAGAGCGTTGTCATATTGAGTACCGCAATCTACAAGACCTACCTATCAATCAGGCGCGGAAAAAGC
    GATGGTTTGCTAGGCACAGGGGTTAGTGCGGCTATGGAGATCATGTCACAAAATCCAGTATCCGTGGGCA
    TAGCAGTCATGCTAGGGGTAGGGGCCGTGGCAGCCCACAATGCAATCGAGGCCAGTGAGCAGAAGAGAAC
    ACTACTCATGAAAGTTTTTGTAAAGAACTTCTTGGACCAAGCAGCCACTGATGAATTAGTCAAGGAGAGT
    CCTGAGAAAATAATAATGGCTTTGTTTGAAGCAGTGCAGACAGTCGGTAACCCTCTTAGACTAGTATACC
    ACCTTTATGGAGTTTTCTATAAGGGGTGGGAGGCAAAAGAGTTGGCCCAAAGGACAGCCGGTAGGAACCT
    TTTCACTTTGATAATGTTCGAGGCTGTGGAACTACTGGGAGTAGATAGTGAAGGAAAGATCCGCCAGCTA
    TCAAGTAATTACATACTAGAGCTCCTGTATAAGTTCCGTGACAGTATCAAGTCTAGCGTGAGGGAGATGG
    CAATCAGCTGGGCCCCTGCCCCTTTCAGCTGTGATTGGACACCGACGGATGACAGAATAGGGCTCCCCCA
    AGACAATTTCCTCCAAGTGGAGACGAAATGCCCCTGTGGTTACAAGATGAAGGCAGTTAAGAATTGTGCT
    GGAGAGCTGAGACTCTTGGAGGAGGAAGGCTCATTTCTCTGCAGAAATAAATTCGGGAGAGGTTCACGGA
    ACTACAGGGTGACAAAATACTATGATGACAATCTATCAGAAATAAAGCCAGTGATAAGAATGGAAGGGCA
    TGTGGAACTCTACTACAAGGGAGCCACCATCAAACTGGACTTCAACAACAGTAAAACAATACTGGCAACC
    GATAAATGGGAGATTGATCACTCCACTCTGGTCAGGGTGCTCAAGAGGCACACAGGGGCTGGATATCATG
    GGGCATACCTGGGCGAGAAACCGAACTACAAACATCTGATAGAGAGGGACTGTGCAACCATCACCAAAGA
    TAAGGTTTGTTTTCTCAAAATGAAGAGAGGGTGTGCATTTACTTATGACTTATCCCTTCACAACCTTACC
    CGACTGATTGAATTGGTACACAAGAATAACTTGGAAGACAAAGAGATTCCTGCTGTTACGGTTACAACCT
    GGCTGGCTTACACGTTTGTAAATGAAGATATAGGGACCATAAAACCAGCCTTCGGGGAGAAAGTAACACC
    GGAGATGCAGGAGGAAATAACCTTGCAGCCTGCTGTAGTGGTGGATACAACTGACGTGACCGTGACTGTG
    GTAGGGGAAGCCCCTACTATGACTACAGGGGAGACTCCGACAGCGTTCACCAGCTCAGGTTCAGACCCGA
    AAGGCCAACAAGTTTTAAAACTGGGGGTAGGTGAAGGCCAATACCCCGGGACTAATCCACAGAGGGCAAG
    CCTGCACGAAGCCATACAAGGTGCAGATGAGAGACCCTCGGTGCTGATATTAGGGTCTGATAAAGCCACC
    TCTAATAGAGTGAAAACTGCAAAGAATGTAAAGGTATACAGAGGCAGGGACCCACTAGAAGTGAGAGATA
    TGATGAGGAGGGGAAAGATCCTGGTCATAGCCCTGTCTAGGGTTGATAATGCTCTATTGAAATTTGTTGA
    CTACAAAGGCACCTTTCTAACTAGAGAGACCCTAGAGGCATTAAGTTTGGGTAGGCCTAAAAAGAAAAAC
    ATAACCAAGGCAGAAGCGCAGTGGTTGCTGTGCCTCGAAGACCAAATGGAAGAGCTACCCGATTGGTTCG
    CAGCCGGGGAACCCATTTTTCTAGAGGCTAACATTAAACATGACAGGTACCATCTGGTGGGGGATATAGC
    TAATATCAAGGAAAAAGCCAAACAGTTGGGAGCTACAGACTCCACAAAGATATCTAAGGAGGTTGGTGCA
    AAAGTGTATTCTATGAAACTGAGTAATTGGGTGATGCAAGAAGAAAATAAACAGGGCAACCTGACCCCCT
    TGTTTGAAGAGCTCCTGCAACAGTGTCCACCCGGAGGCCAGAACAAAACTGCACATATGGTCTCTGCTTA
    CCAACTAGCTCAAGGGAACTGGATGCCAACCAGCTGCCATGTTTTTATGGGGACCATATCTGCCAGGAGG
    ACCAAGACCCATCCATATGAAGCATACGTCAAGTTAAGGGAGTTGGTAGAGGAACACAAGATGAAAACAT
    TGTGTCCTGGATCAAGCCTGGGTAAGCACAACGAATGGATAATTGGTAAAATCAAATACCAGGGAAACCT
    GAGGACCAAACACATGTTGAACCCCGGCAAGGTGGCAGAGCAACTGTGCAGAGAGGGACACAGACACAAT
    GTGTATAACAAGACAATAGGCTCAGTAATGACAGCTACTGGTATCAGGTTGGAGAAGTTGCCCGTGGTTA
    GGGCCCAGACAGACACAACCAACTTCCACCAAGCAATAAGGGATAAGATAGACAAGGAAGAGAACCTACA
    AACCCCGGGTTTACATAAGAAACTAATGGAAGTTTTCAATGCATTGAAACGACCCGAGTTAGAGTCCTCC
    TACGATGCCGTGGAATGGGAGGAACTGGAGAGAGGAATAAACAGGAAGGGTGCTGCTGGTTTCTTTGAAC
    GCAAAAATATAGGGGAAATATTGGATTCAGAGAAAAACAAAGTCGAAGAGATTATTGACAATCTGAAAAA
    AGGCAGAAACATCAAATACTATGAAACCGCGATCCCAAAGAATGAGAAGAGGGACGTCAATGATGACTGG
    ACTGCTGGTGACTTCGTGGAAGAGAAGAAACCCAGAGTCATACAATACCCTGAAGCAAAAACAAGGCTGG
    CCATCACCAAGGTGATGTATAAGTGGGTGAAGCAGAAGCCAGTAGTTATACCCGGGTATGAAGGGAAGAC
    ACCTCTATTCCAAATTTTTGACAAAGTAAAGAAGGAATGGGATCAATTCCAAAATCCAGTGGCAGTGAGT
    TTTGACACTAAGGCGTGGGACACCCAGGTAACCACAAAAGATTTGGAGTTGATAAAGGACATACAAAAGT
    ACTATTTCAAGAAGAAATGGCATAAATTTATTGACACCCTGACCATGCACATGTCAGAAGTACCCGTAAT
    CAGTGCTGATGGGGAAGTATACATAAGGAAAGGGCAAAGAGGCAGTGGACAACCTGACACAAGCGCAGGC
    AATAGCATGCTAAATGTGTTAACAATGATTTACGCCTTCTGCGAGGCCACGGGAGTACCCTACAAGAGCT
    TCGACAGGGTGGCAAAAATTCATGTGTGTGGGGATGATGGTTTCCTGATCACAGAAAGAGCTCTCGGTGA
    GAAATTCGCGAGTAAGGGAGTCCAGATCCTATATGAAGCTGGGAAGCCCCAGAAGATCACTGAAGGGGAC
    AAGATGAAAGTGGCCTACCAATTTGATGATATTGAGTTTTGCTCCCATACACCAATACAAGTAAGGTGGT
    CAGATAACACTTCTAGTTACATGCCGGGGAGAAATACAACCACAATCCTGGCTAAAATGGCCACAAGGTT
    AGATTCCAGTGGTGAGAGGGGTACCATAGCATATGAGAAAGCAGTAGCATTCAGCTTCCTGCTGATGTAC
    TCCTGGAACCCACTAATCAGAAGGATCTGCTTACTGGTGCTATCAACTGAACTGCAAGTGAAACCAGGGA
    AGTCAACCACTTACTACTATGAAGGGGACCCGATATCTGCCTACAAGGAAGTCATCGGCCACAATCTTTT
    TGATCTTAAGAGAACAAGCTTCGAGAAGCTGGCCAAGTTAAATCTCAGCATGTCAGTACTCGGAGCCTGG
    ACTAGACACACCAGTAAAAGACTACTACAAGACTGTGTCAATGTGGGTGTTAAAGAGGGCAACTGGCTAG
    TTAATGCAGATAGACTAGTAAGTAGCAAGACTGGAAATAGGTACATACCCGGAGAGGGCCACACCCTGCA
    AGGGAGACATTATGAAGAACTGGTGTTGGCAAGAAAACAGATCAACAACTTTCAAGGGACCGACAGGTAC
    AATCTAGGCCCAATAGTCAATATGGTGTTAAGGAGGCTGAGAGTCATGATGATGACCCTGATAGGGAGAG
    GGGTATG
    
    
  • Protein Sequence : Show Sequence
    >NP_075354.1 polyprotein [Classical swine fever virus]
    MELNHFELLYKTNKQKPMGVEEPVYDATGRPLFGDPSEVHPQSTLKLPHDRGRGNIKTTLKNLPRKGDCR
    SGNHLGPVSGIYVKPGPVFYQDYMGPVYHRAPLEFFNEAQFCEVTKRIGRVTGSDGKLYHIYVCIDGCIL
    LKLAKRDEPRTLKWIRNFTDCPLWVTSCSDDGASGSKEKKPDRINKGKLKIAPKEHEKDSRTKPPDATIV
    VEGVKYQVKKKGKVKGKSTQDGLYHNKNKPPESRKKLEKALLAWAVIAIMLYQPVEAENITQWNLSDNGT
    NGIQHAMYLRGVSRSLHGIWPEKICKGVPTYLATDTELKEIQGMMDASEGTNYTCCKLQRHEWNKHGWCN
    WYNIDPWIQLMNRTQANLAEGPPAKECAVTCRYDKDADINVVTQARNRPTTLTGCKKGKNFSFAGTVIEG
    PCNFNVSVEDILYGDHECGSLLQDTALYLVDGMTNTIENARQGAARVTSWLGRQLSTAGKRLEGRSKTWF
    GAYALSPYCNVTSKIGYIWYTNNCTPACLPKNTKIIGPGKFDTNAEDGKILHEMGGHLSEFLLLSLVVLS
    DFAPETASALYLILHYMIPQSHEEPEGCDTNQLNLTVELRTEDVIPSSVWNVGKYVCVRPDWWPYETKVA
    LLFEEAGQVVKLALRALRDLTRVWNSASTTAFLICLIKVLRGQIVQGVIWLLLVTGAQGRLACKEDYRYA
    ISSTNEIGLLGAEGLTTTWKEYNHDLQLNDGTVKAICVAGSFKVIALNVVSRRYLASLHKEASLTSVTFE
    LLFDGTNPSTEEMGDDFGFGLCPFDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECTAVSPTTLRTEV
    VKTFRRDKPFPHRMDCATTTVENGDLFYCKLGGNWTCVKGEPVVYTGGLVKQCRWCGFDFNEPDGLPHYP
    IGKCILVNETGYRIVDSTDCNRDGVVISTDGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPVRK
    TSCTFNYAKTLKNKYYEPRDSYFQQYMLKGEYQYWFDLDVTDRHSDYFAEFVVLVVVALLGGRYVLWLIV
    TYIVLTEQLAAGLPLGQGEVVLIGNLITHTDIEVVVYFLLLYLVMRDEPIKKWILLLFHAMTNNPVKTIT
    VALLMVSGVAKGGKIDGGWQRLPETSFDIQLALTVIVVAVMLLAKRDPTTVPLVITVATLRTAKMTNGLS
    TDIAIATVSTALLTWTYISDYYRYKTWLQYLISTVTGIFLIRVLKGIGELDLHTPTLPSYRPLFFILVYL
    ISTAVVTRWNLDIAGLLLQCVPTLLMVFTMWADILTLILILPTYELTKLYYLKEVKTGAEKGWLWKTNFK
    RVNDIYEVDQSGEGVYLFPSKQKTSSITGTMLPLIKAILISCISNKWQFIYLLYLIFEVSYYLHKKIIDE
    IAGGTNFISRLVAALIEANWAFDNEEVRGLKKFFLLSSRVKELIIKHKVRNEVMVHWFGDEEVYGMPKLV
    GLVKAATLSKNKHCILCTVCEDREWRGETCPKCGRFGPPMTCGMTLADFEEKHYKRIFFREDQSEGPVRE
    EYAGYLQYRARGQLFLRNLPVLATKVKMLLVGNLGTEVGDLEHLGWVLRGPAVCKKVTEHEKCTTSIMDK
    LTAFFGVMPRGTTPRAPVRFPTSLLKIRRGLETGWAYTHQGGISSVDHVTCGKDLLVCDTMGRTRVVCQS
    NNKMTDESEYGVKTDSGCPEGARCYVFNPEAVNISGTKGAMVHLQKTGGEFTCVTASGTPAFFDLKNLKG
    WSGLPIFEASSGRVVGRVKVGKNEDSKPTKLMSGIQTVSKSTTDLTEMVKKITTMNRGEFRQITLATGAG
    KTTELPRSVIEEIGRHKRVLVLIPLRAAAESVYQYMRQKHPSIAFNLRIGEMKEGDMATGITYASYGYFC
    QMPQPKLRAAMVEYSFIFLDEYHCATPEQLAIMGKIHRFSENLRVVAMTATPAGTVTTTGQKHPIEEFIA
    PEVMKGEDLGSEYLDIAGLKIPVEEMKSNMLVFVPTRNMAVETAKKLKAKGYNSGYYYSGEDPSNLRVVT
    SQSPYVVVATNAIESGVTLPDLDVVVDTGLKCEKRIRLSPKMPFIVTGLKRMAVTIGEQAQRRGRVGRVK
    PGRYYRSQETPVGSKDYHYDLLQAQRYGIEDGINITKSFREMNYDWSLYEEDSLMITQLEILNNLLISEE
    LPMAVKNIMARTDHPEPIQLAYNSYETQVPVLFPKIKNGEVTDSYDNYTFLNARKLGDDVPPYVYATEDE
    DLAVELLGLDWPDPGNQGTVEAGRALKQVVGLSTAENALLVALFGYVGYQALSKRHIPVVTDIYSIEDHR
    LEDTTHLQYAPNAIKTEGKETELKELAQGDVQRCVEAMTNYAREGIQFMKSQALKVKETPTYKETMNTVT
    DYVKKFMEALADSKEDILRYGLWGTHTALYKSISARLGSETAFATLVVKWLAFGGESIADHVKQAATDLV
    VYYIINRPQFPGDTETQQEGRKFVASLLVSALATYTYKSWNYNNLSKIVEPALATLPYAATALKLFAPTR
    LESVVILSTAIYKTYLSIRRGKSDGLLGTGVSAAMEIMSQNPVSVGIAVMLGVGAVAAHNAIEASEQKRT
    LLMKVFVKNFLDQAATDELVKESPEKIIMALFEAVQTVGNPLRLVYHLYGVFYKGWEAKELAQRTAGRNL
    FTLIMFEAVELLGVDSEGKIRQLSSNYILELLYKFRDSIKSSVREMAISWAPAPFSCDWTPTDDRIGLPQ
    DNFLQVETKCPCGYKMKAVKNCAGELRLLEEEGSFLCRNKFGRGSRNYRVTKYYDDNLSEIKPVIRMEGH
    VELYYKGATIKLDFNNSKTILATDKWEIDHSTLVRVLKRHTGAGYHGAYLGEKPNYKHLIERDCATITKD
    KVCFLKMKRGCAFTYDLSLHNLTRLIELVHKNNLEDKEIPAVTVTTWLAYTFVNEDIGTIKPAFGEKVTP
    EMQEEITLQPAVVVDTTDVTVTVVGEAPTMTTGETPTAFTSSGSDPKGQQVLKLGVGEGQYPGTNPQRAS
    LHEAIQGADERPSVLILGSDKATSNRVKTAKNVKVYRGRDPLEVRDMMRRGKILVIALSRVDNALLKFVD
    YKGTFLTRETLEALSLGRPKKKNITKAEAQWLLCLEDQMEELPDWFAAGEPIFLEANIKHDRYHLVGDIA
    NIKEKAKQLGATDSTKISKEVGAKVYSMKLSNWVMQEENKQGNLTPLFEELLQQCPPGGQNKTAHMVSAY
    QLAQGNWMPTSCHVFMGTISARRTKTHPYEAYVKLRELVEEHKMKTLCPGSSLGKHNEWIIGKIKYQGNL
    RTKHMLNPGKVAEQLCREGHRHNVYNKTIGSVMTATGIRLEKLPVVRAQTDTTNFHQAIRDKIDKEENLQ
    TPGLHKKLMEVFNALKRPELESSYDAVEWEELERGINRKGAAGFFERKNIGEILDSEKNKVEEIIDNLKK
    GRNIKYYETAIPKNEKRDVNDDWTAGDFVEEKKPRVIQYPEAKTRLAITKVMYKWVKQKPVVIPGYEGKT
    PLFQIFDKVKKEWDQFQNPVAVSFDTKAWDTQVTTKDLELIKDIQKYYFKKKWHKFIDTLTMHMSEVPVI
    SADGEVYIRKGQRGSGQPDTSAGNSMLNVLTMIYAFCEATGVPYKSFDRVAKIHVCGDDGFLITERALGE
    KFASKGVQILYEAGKPQKITEGDKMKVAYQFDDIEFCSHTPIQVRWSDNTSSYMPGRNTTTILAKMATRL
    DSSGERGTIAYEKAVAFSFLLMYSWNPLIRRICLLVLSTELQVKPGKSTTYYYEGDPISAYKEVIGHNLF
    DLKRTSFEKLAKLNLSMSVLGAWTRHTSKRLLQDCVNVGVKEGNWLVNADRLVSSKTGNRYIPGEGHTLQ
    GRHYEELVLARKQINNFQGTDRYNLGPIVNMVLRRLRVMMMTLIGRGV
    
    
  • Molecule Role : Virmugen
  • Molecule Role Annotation : A E2 mutant in Classical swine fever virus is attenuated and provides protection in pigs after oronasal vaccination (not intradermal vaccination) against lethal challenge dose of CSFV strain Eystrup (Maurer et al., 2005).
  • Additional Molecule Role : Protective antigen
  • Related Vaccine(s): Classical Swine Fever Virus DNA Vaccine pcDNA/E2 with TRIF , Classical swine fever virus DNA vaccine pCI-gp55 , Classical swine fever virus E2 mutant vaccine , DNA vaccine expressing the E2 protein , rORFV-CSFV-E2
6. E2
  • Gene Name : E2
  • Sequence Strain (Species/Organism) : Classical swine fever virus strain Shimen
  • NCBI Protein GI : 221063268
  • Other Database IDs : CDD:292945
  • Taxonomy ID : 11096
  • Gene Strand (Orientation) : ?
  • Protein Name : E2 glycoprotein
  • Protein pI : 5.93
  • Protein Weight : 38594.42
  • Protein Length : 447
  • Protein Note : highly virulent group I strain
  • Protein Sequence : Show Sequence
    >ACL98471.1 E2 glycoprotein, partial [Classical swine fever virus]
    RLACKEDYRYAISSTNEIGPLGAGGLTTTWKEYSHDLQLYDGTVKAICVAGSFKVTALNVVSRRYLASLH
    KGALLTSVTFELLFDGTNPSTEEMGDDFGFGLCPFDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECT
    AVSPTTLRTEVVKTFRREKPFPHRMDCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGQVKQCKWCGFD
    FNEPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISAEGSHECLIGNTTVKVHASDERLGPMPCRPK
    EIVSSAGPVRKTSCTFNYAKTLKNKYYEPRDSYFQQYMLKGEYQYWFDLDVTDRHSDYFAEFVVLVVVAL
    LGGRYVLWLIVTYIVLTEQLAAG
    
    
  • Molecule Role : Protective antigen
7. gp55
  • Gene Name : gp55
  • VO ID : VO_0010899
  • NCBI Protein GI : 1763691
  • Other Database IDs : CDD:292945
  • Taxonomy ID : 11096
  • Gene Strand (Orientation) : ?
  • Protein Name : glycoprotein
  • Protein pI : 6.6
  • Protein Weight : 38891.77
  • Protein Length : 452
  • Protein Note : Pestivirus envelope glycoprotein E2; pfam16329
  • Protein Sequence : Show Sequence
    >AAB39835.1 glycoprotein, partial [Classical swine fever virus]
    VQGVVWLLLVTGAQGRLACKEDYRYAISSTDEIGLLGAGGLTTTWKEYNHDLQLNDGTVKASCVAGSFKV
    TALNVVSRRYLASLHKKALPISVTFELLFDGTNPSTEEMEDDLRSGLCPFDTSPVVKGKYNTTLLNGSAF
    YLVCPIGWTGVIECTAVSPTTLRTEVVKTFRRDKPFPHRMDCVTTTVENEDLFYCKLGGNWTCVKGEPVV
    YTGGVVKQCRWCGFDFDGPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISTEGSHECLIGNTAVKV
    HASDERLGPMPCRPKEIVSSAGPVMKTSCTFNYTKTLKNRYYEPRDSYFRQYMLKGEYQYWFDLDATDRH
    SDYFAEFVVLVVVALLRGRYVLWLIVTYAVL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Intramuscular vaccination of pigs with immunoaffinity-purified E1 (gp55) in a double water-oil emulsion elicited high titers of neutralizing antibodies between 2 and 4 weeks after vaccination at the lowest dose tested (20 micrograms). The vaccinated pigs were completely protected against intranasal challenge with 100 50% lethal doses of HCV (Classical swine fever virus) strain Brescia (Hulst et al., 1993).
  • Related Vaccine(s): Classical swine fever virus E1 protein vaccine
III. Vaccine Information
1. Bayovac CSF E2
a. Tradename:
Bayovac CSF E2
b. Manufacturer:
Bayer Leverkusen
c. Vaccine Ontology ID:
VO_0000951
d. Type:
Recombinant vector vaccine
e. Status:
Licensed
f. Host Species for Licensed Use:
Pig
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
Baculovirus recombinant E2 protein without emulsion(Moormann et al., 2000)
2. Classical Swine Fever Virus DNA Vaccine pcDNA/E2 with TRIF
a. Vaccine Ontology ID:
VO_0004524
b. Type:
DNA vaccine
c. Status:
Research
d. Gene Engineering of E2
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pRK-TRIF (Wan et al., 2010)
f. Immunization Route
Intramuscular injection (i.m.)
g. Mouse Response
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Co-delivery of the DNA vaccine pcDNA/E2 with the TRIF adjuvant enhanced the cellular, not humoral, immune responses induced by DNA vaccines in mice (Wan et al., 2010).
  • Challenge Protocol: All immunized pigs were intramuscularly challenged 2 weeks after the last immunization with 105 TCID50 highly virulent CSFV Shimen strain (Wan et al., 2010).
  • Efficacy: All pigs co-immunized with pcDNA/E2 + pRK-TRIF survived viral challenge., though two pigs in this groups had a slight fever but recovered with 1 or 3 days and the remaining pig in this group had no CSF signs (Wan et al., 2010).
h. Pig Response
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: All immunized pigs were intramuscularly challenged 2 weeks after the last immunization with 105 TCID50 highly virulent CSFV Shimen strain (Wan et al., 2010).
  • Efficacy: All pigs co-immunized with pcDNA/E2 + pRK-TRIF survived viral challenge., though two pigs in this groups had a slight fever but recovered with 1 or 3 days and the remaining pig in this group had no CSF signs (Wan et al., 2010).
3. Classical swine fever virus DNA vaccine pCI-gp55
a. Vaccine Ontology ID:
VO_0004340
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of E2
  • Type: DNA vaccine construction
  • Description: Vector pCI expressed the gp55/E2 gene from classical swine fever virus (CSFV) (Hammond et al., 2001).
  • Detailed Gene Information: Click here.
f. Vector:
pCI (Hammond et al., 2001)
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: Following challenge with CSFV, 100% of weaned pigs and 75% pre-weaned piglets were protected from disease (Hammond et al., 2001).
4. Classical swine fever virus E(rns) mutant vaccine
a. Vaccine Ontology ID:
VO_0002952
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of E(rns)
  • Type: Gene mutation
  • Description: This E(rns) mutant is from Classical swine fever virus (Sainz et al., 2008).
  • Detailed Gene Information: Click here.
f. Immunization Route
intranasal immunization
g. Pig Response
  • Persistence: An E(rns) mutant is attenuated in swine (Sainz et al., 2008).
  • Efficacy: An E(rns) mutant induces protection in swine from challenge with wild type CSVF (Sainz et al., 2008).
5. Classical swine fever virus E1 mutant vaccine
a. Vaccine Ontology ID:
VO_0002953
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of E1
f. Immunization Route
intranasal immunization
g. Pig Response
6. Classical swine fever virus E1 protein vaccine
a. Vaccine Ontology ID:
VO_0011509
b. Type:
Subunit vaccine
c. Status:
Research
d. Antigen
Classical swine fever virus gp55 encoding E1
e. Gene Engineering of gp55
  • Type: Recombinant protein preparation
  • Description: A recombinant virus BacEl[-], which expressed El without a C-terminal TMR, generated a protein that was secreted from the cells. The fraction of this protein that was found to be cell associated had a slightly lower molecular mass (49 to 52 kDa) than wild-type El and remained endo H sensitive. The high-mannose units of the secreted protein were trimmed during transport through the exocytotic pathway to endo H-resistant glycans, resulting in a protein with a lower molecular mass (46 to 48 kDa) (Hulst et al., 1993).
  • Detailed Gene Information: Click here.
f. Vector:
Baculovirus vector
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Vaccination Protocol: Groups of two specific-pathogen-free, 10- to 12-week-old pigs were inoculated intramuscularly with a double water-oil emulsion of immunoaffinity-purified El on day 0. Pigs 1, 2, 3, and 4 were inoculated with 20 ug of El, and pigs 6, 7, 8, and 9 were inoculated with 100 ug of El. After 28 days, pigs 3 and 4 were vaccinated again with 20 ug and pigs 8 and 9 were vaccinated with 100 ug of immunoaffinity-purified El. Pigs 5 and 10 (control pigs) were inoculated on day 0 with a double water-oil emulsion of SF900 medium from Sf21 cells infected with wild-type AcNPV and vaccinated again with the same inoculum on day 28 (Hulst et al., 1993).
  • Challenge Protocol: Pigs of all groups were challenged intranasally on day 42 with 100 50% lethal doses of HCV strain Brescia 456610, a challenge dose that, in unprotected pigs, leads to acute disease characterized by high fever and thrombocytopenia starting at days 3 to 5 and to death at days 7 to 11(Hulst et al., 1993).
  • Efficacy: Intramuscular vaccination of pigs with immunoaffinity-purified E1 (gp55) in a double water-oil emulsion elicited high titers of neutralizing antibodies between 2 and 4 weeks after vaccination at the lowest dose tested (20 micrograms). The vaccinated pigs were completely protected against intranasal challenge with 100 50% lethal doses of HCV (Classical swine fever virus) strain Brescia (Hulst et al., 1993).
7. Classical swine fever virus E2 mutant vaccine
a. Vaccine Ontology ID:
VO_0002954
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Pig
e. Gene Engineering of E2
  • Type: Gene mutation
  • Description: This E2 mutant is from Classical swine fever virus (Maurer et al., 2005).
  • Detailed Gene Information: Click here.
f. Immunization Route
Oronasal immunization
g. Pig Response
  • Persistence: An E2 mutant is attenuated in swine (Maurer et al., 2005).
  • Efficacy: An E2 mutant induced significant protection in swine from challenge with wild type CSFV (Maurer et al., 2005).
8. Classical swine fever virus vaccine VAC-E0
a. Vaccine Ontology ID:
VO_0011427
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Antigen
Classical swine fever virus envelope glycoprotein E0
e. Gene Engineering of E0
  • Type: Recombinant vector construction
  • Description: A 0.7-kbp fragment (corresponding to nucleotides 1114 to 1838 of CSFV Alfort Tu¨bingen which encompassed the coding sequence for all but 5 amino acids (aa) of CSFV E0 was isolated from plasmid pHCK11 by digestion with BglI and BanI. The missing codons were substituted for with synthetic adaptor oligonucleotides. The 59 adaptor BBA (59GATCCACCAT GGGGGCCCTGT39) linked the BglI site of the 0.7-kbp fragment to the BamHI site of pGS62 and contained a sequence according to Kozak’s rules. Besides the initial methionine, BBA coded for 3 aa: glycine (not found in the CSFV sequence) and alanine and leucine (corresponding to CSFV aa 250 and 251). The 39 adaptor BEA (59GTGCCTATGCCTGAGTTA39) connected the BanI site of the 0.7-kbp fragment to the EcoRI site of pGS62 and encoded amino acids corresponding to glycine 491 to alanine 494 of CSFV as well as a stop codon. After ligation with adaptors BBA and BEA, the 0.7-kbp fragment was introduced into recombination vector pGS62 to derive plasmid pGS62-E0 (König et al., 1995). To generate a VVR vaccine, CVI cells were infected with vaccinia virus strain WR (VAC-WR) at a multiplicity of infection (MOI) of 0.05 and after 1 h were transfected with the respective recombination plasmids by using a mammalian transfection kit. After 48 h of incubation, virus progeny was harvested by repeated freezing and thawing. Selection for a thymidine kinase-negative phenotype on human 143tk2 cells was carried out with medium containing 1% agarose and 100 mg of bromodeoxyuridine per ml. VVR were isolated from thymidine kinase negative virus plaques and were plaque purified twice (König et al., 1995).
  • Detailed Gene Information: Click here.
f. Vector:
Recombinant Vaccinia Virus
g. Immunization Route
Intradermal injection (i.d.)
h. Pig Response
  • Vaccination Protocol: Pigs were vaccinated with a single dose of VVR (VAC-E0 or VAC-E2) or control strain VAC-WR by three different routes simultaneously (intradermally, intraperitoneally, and intravenously). A total of 5 x 107 PFU of VVR was given by each route. Clinical reactions after vaccination were monitored by daily examination (König et al., 1995).
  • Challenge Protocol: The pigs were challenged intranasally 5 weeks after immunization with 2 x 107 50% tissue culture infective doses of CSFV Alfort Tu¨bingen. Clinical symptoms were monitored daily. Blood samples were taken at days 5 and 12 postinfection (p.i.) and at the slaughter of the animals (days 12 to 27 p.i.) (König et al., 1995).
  • Efficacy: Swine vaccinated with VVR expressing E0 and/or E2 resisted a lethal challenge infection with CSFV. Glycoprotein E0 represents a second determinant for the induction of protective immunity against classical swine fever (König et al., 1995).
9. Classical swine fever virus vaccine VAC-E2
a. Vaccine Ontology ID:
VO_0011508
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Antigen
Classical swine fever virus E2
e. Gene Engineering of E2
  • Type: Recombinant vector construction
  • Description: A 1.5-kbp DNA fragment (representing nucleotides 2433 to 3971 of CSFV Alfort Tu¨bingen) isolated from clone pHCK11 by NheI-HpaI digestion was ligated into plasmid pBR02-16/4. The resulting construct contained the nucleotide sequences for CSFV E2 and PRV-SP. Isolation of the PRV-SP E2 sequence and introduction into vector pGS62 gave rise to pGS62-E2 (König et al., 1995).
  • Detailed Gene Information: Click here.
f. Vector:
Recombinant Vaccinia Virus
g. Immunization Route
Intradermal injection (i.d.)
h. Pig Response
  • Vaccination Protocol: Pigs were vaccinated with a single dose of VVR (VAC-E0 or VAC-E2) or control strain VAC-WR by three different routes simultaneously (intradermally, intraperitoneally, and intravenously). A total of 5 x 107 PFU of VVR was given by each route. Clinical reactions after vaccination were monitored by daily examination (König et al., 1995).
  • Challenge Protocol: The pigs were challenged intranasally 5 weeks after immunization with 2 x 107 50% tissue culture infective doses of CSFV Alfort Tu¨bingen. Clinical symptoms were monitored daily. Blood samples were taken at days 5 and 12 postinfection (p.i.) and at the slaughter of the animals (days 12 to 27 p.i.) (König et al., 1995).
  • Efficacy: Swine vaccinated with VVR expressing E0 and/or E2 resisted a lethal challenge infection with CSFV. Glycoprotein E0 represents a second determinant for the induction of protective immunity against classical swine fever (König et al., 1995).
10. DNA vaccine expressing the E2 protein
a. Vaccine Ontology ID:
VO_0004514
b. Type:
Live, attenuated vaccine
c. Status:
Licensed
d. Gene Engineering of E2
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
e. Vector:
pcDNA3.1+ (Tarradas et al., 2011)
f. Immunization Route
Intramuscular injection (i.m.)
g. Pig Response
  • Vaccination Protocol: Groups of 3 pigs were used in each experimental group. Briefly, group 1 (pE2) was inoculated with 500 μg of plasmid pE2 in co-injection with 500 μg of pcDNA3.1 (empty plasmid, Invitrogen), group 2 (pE2 + pCCL20) was inoculated with 500 μg pE2 in co-injection with 500 μg of pCCL20, and the control group was injected with PBS. In all cases, three doses were administered intramuscularly in the neck every 12 days. Before every immunization (at days 0, 12 and 24), pigs were bled to follow the CSFV specific immunoresponse (Tarradas et al., 2011).
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: The vaccine is able to increase antibody-mediated responses, while enhancing the T helper cell response associated with the induction of neutralizing antibodies against CSFV (Tarradas et al., 2011).
  • Challenge Protocol: Thirty-six days after the first immunization (pre-challenge), all pigs were challenged with 105 DICT50 of CSFV virulent Margarita strain by i.m. injection in the neck (Tarradas et al., 2011).
  • Efficacy: Immunized animals with E2 DNA vaccine in co-administration with the plasmid containing swine CCL20 developed high titers of neutralizing antibodies against homologous and heterologous CSFV strains, and were totally protected upon a lethal viral challenge (Tarradas et al., 2011).
11. Porcilis Pesti
a. Tradename:
Porcilis Pesti
b. Manufacturer:
Intervet
c. Vaccine Ontology ID:
VO_0000981
d. Type:
Recombinant vector vaccine
e. Status:
Licensed
f. Host Species for Licensed Use:
Pig
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
Baculovirus recombinant E2 protein without emulsion(van, 2003)
12. rAdV-SFV-E2
a. Vaccine Ontology ID:
VO_0004700
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Pig
e. Preparation
An adenovirus-vectored Semliki forest virus replicon construct expressing the E2 glycoprotein from CSFV, rAdV-SFV-E2 (Sun et al., 2013).
f. Immunization Route
Intramuscular injection (i.m.)
g. Pig Response
  • Vaccine Immune Response Type: VO_0003057
  • Efficacy: Two immunizations with a dose as low as 6.25×105 TCID(50) or a single immunization with a dose of 107 TCID(50) rAdV-SFV-E2 provided complete protection against a lethal CSFV challenge (Sun et al., 2013).
13. rORFV-CSFV-E2
a. Vaccine Ontology ID:
VO_0004768
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of E2
  • Type: Recombinant vector construction
  • Description: Using the new recombinant parapoxvirus (PPV) Orf virus (ORFV) as a vaccine expressing the CSFV E. (Voigt et al., 2007).
  • Detailed Gene Information: Click here.
f. Preparation
(Voigt et al., 2007) the recombinant parapoxvirus (PPV) Orf virus (ORFV) as a vaccine expressing the CSFV E2 glycoprotein to protect CSFV chellange.
g. Immunization Route
Intramuscular injection (i.m.)
h. Pig Response
  • Vaccination Protocol: Pigs were vaccinated with ORFV (Voigt et al., 2007).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: Pigs were challenged with CSFV (Voigt et al., 2007).
  • Efficacy: Vector virus vaccinated swine were able to cope with the lymphocyte and in particular B-cell depression in peripheral blood after challenge showing no clinical signs and no viremia. Also, the vaccinated swine demonstrated that a single intra-muscular application confers solid protection (Voigt et al., 2007).
14. rPFV-CSFV-E0
a. Vaccine Ontology ID:
VO_0004748
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Preparation
CSFV E0 gene was amplified from the plasmid pMD18-T-E0 by PCR and cloned into the FPV-P11 and FPV-pSY (Wang et al., 2008).
f. Immunization Route
Intramuscular injection (i.m.)
g. Pig Response
  • Vaccination Protocol: Piglets were immunized three times with recombinant Fowlpox virus (Wang et al., 2008).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: The pigs were challenged with CSFV (Wang et al., 2008).
  • Efficacy: The protection experiment showed that 75% of piglets immunized three times with recombinant Fowlpox virus were survived, indicating that the recombinant Fowlpox virus was effective (Wang et al., 2008).
IV. References
1. Fernandez-Sainz et al., 2009: Fernandez-Sainz I, Holinka LG, Gavrilov BK, Prarat MV, Gladue D, Lu Z, Jia W, Risatti GR, Borca MV. Alteration of the N-linked glycosylation condition in E1 glycoprotein of Classical Swine Fever Virus strain Brescia alters virulence in swine. Virology. 2009; 386(1); 210-216. [PubMed: 19203774].
2. Hammond et al., 2001: Hammond JM, Jansen ES, Morrissy CJ, Goff WV, Meehan GC, Williamson MM, Lenghaus C, Sproat KW, Andrew ME, Coupar BE, Johnson MA. A prime-boost vaccination strategy using naked DNA followed by recombinant porcine adenovirus protects pigs from classical swine fever. Veterinary microbiology. 2001; 80(2); 101-119. [PubMed: 11295331].
3. Hulst et al., 1993: Hulst MM, Westra DF, Wensvoort G, Moormann RJ. Glycoprotein E1 of hog cholera virus expressed in insect cells protects swine from hog cholera. Journal of virology. 1993; 67(9); 5435-5442. [PubMed: 8350404].
4. König et al., 1995: König M, Lengsfeld T, Pauly T, Stark R, Thiel HJ. Classical swine fever virus: independent induction of protective immunity by two structural glycoproteins. Journal of virology. 1995; 69(10); 6479-6486. [PubMed: 7666549].
5. Lin et al., 2009: Lin GJ, Liu TY, Tseng YY, Chen ZW, You CC, Hsuan SL, Chien MS, Huang C. Yeast-expressed classical swine fever virus glycoprotein E2 induces a protective immune response. Veterinary microbiology. 2009; 139(3-4); 369-374. [PubMed: 19625145].
6. Maurer et al., 2005: Maurer R, Stettler P, Ruggli N, Hofmann MA, Tratschin JD. Oronasal vaccination with classical swine fever virus (CSFV) replicon particles with either partial or complete deletion of the E2 gene induces partial protection against lethal challenge with highly virulent CSFV. Vaccine. 2005; 23(25); 3318-3328. [PubMed: 15837238].
7. Moormann et al., 2000: Moormann RJ, Bouma A, Kramps JA, Terpstra C, De Smit HJ. Development of a classical swine fever subunit marker vaccine and companion diagnostic test. Veterinary microbiology. 2000; 73(2-3); 209-219. [PubMed: 10785329].
8. Sainz et al., 2008: Sainz IF, Holinka LG, Lu Z, Risatti GR, Borca MV. Removal of a N-linked glycosylation site of classical swine fever virus strain Brescia Erns glycoprotein affects virulence in swine. Virology. 2008; 370(1); 122-129. [PubMed: 17904607].
9. Sun et al., 2013: Sun Y, Tian DY, Li S, Meng QL, Zhao BB, Li Y, Li D, Ling LJ, Liao YJ, Qiu HJ. Comprehensive evaluation of the adenovirus/alphavirus-replicon chimeric vector-based vaccine rAdV-SFV-E2 against classical swine fever. Vaccine. 2013; 31(3); 538-544. [PubMed: 23153441].
10. Tarradas et al., 2011: Tarradas J, Álvarez B, Fraile L, Rosell R, Muñoz M, Galindo-Cardiel I, Domingo M, Dominguez J, Ezquerra A, Sobrino F, Ganges L. Immunomodulatory effect of swine CCL20 chemokine in DNA vaccination against CSFV. Veterinary immunology and immunopathology. 2011; 142(3-4); 243-251. [PubMed: 21684019].
11. van, 2003: van Aarle P. Suitability of an E2 subunit vaccine of classical swine fever in combination with the E(rns)-marker-test for eradication through vaccination. Developments in biologicals. 2003; 114; 193-200. [PubMed: 14677689].
12. Voigt et al., 2007: Voigt H, Merant C, Wienhold D, Braun A, Hutet E, Le Potier MF, Saalmüller A, Pfaff E, Büttner M. Efficient priming against classical swine fever with a safe glycoprotein E2 expressing Orf virus recombinant (ORFV VrV-E2). Vaccine. 2007; 25(31); 5915-5926. [PubMed: 17600594].
13. Wan et al., 2010: Wan C, Yi L, Yang Z, Yang J, Shao H, Zhang C, Pan Z. The Toll-like receptor adaptor molecule TRIF enhances DNA vaccination against classical swine fever. Veterinary immunology and immunopathology. 2010; 137(1-2); 47-53. [PubMed: 20466439].
14. Wang et al., 2008: Wang YH, Li PH, Zhang MT, Zhang YM. [Construction of recombinant fowlpox virus expressing E0 gene of classical swine fever virus shimen strain and the animal immunity experiment]. Bing du xue bao = Chinese journal of virology / [bian ji, Bing du xue bao bian ji wei yuan hui]. 2008; 24(1); 59-63. [PubMed: 18320824].
15. Wiki: Classical swine fever: Classical swine fever [http://en.wikipedia.org/wiki/Classical_swine_fever_virus]