VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Feline leukemia virus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. env from FeLV-A/Glasgow (Protective antigen)
    2. Env from strain FRA (Protective antigen)
    3. Gag (Protective antigen)
  3. Vaccine Information
    1. ALVAC-FL- env/gag
    2. EURIFEL FeLV
    3. Feline Immunodeficiency-Leukemia Virus Killed Virus Vaccine (USDA: 15D5.R0)
    4. Feline Leukemia Killed Virus Vaccine (USDA: 1555.20)
    5. Feline Leukemia Killed Virus Vaccine (USDA: 1555.21)
    6. Feline Leukemia Killed Virus Vaccine (USDA: 1555.22
    7. Feline Leukemia Killed Virus Vaccine (USDA: 1555.R1)
    8. Feline Leukemia Live Canarypox Vector Vaccine (USDA: 1555.R3)
    9. Feline Leukemia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1A69.20)
    10. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20)
    11. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21)
    12. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20)
    13. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21)
    14. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20)
    15. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23)
    16. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C)
    17. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B)
    18. FeLV DNA vaccine gag/pol and env
  4. References
I. General Information
1. NCBI Taxonomy ID:
11768
2. Disease:
Feline leukemia virus infection
3. Introduction
Feline leukemia virus (FeLV) is a retrovirus that infects cats. As a retrovirus, FeLV is transmitted as an RNA virus but the RNA is reverse transcribed into DNA. Retroviruses contradict the Central dogma of molecular biology. FeLV is usually transmitted between infected cats when the transfer of saliva or nasal secretions is involved. If not defeated by the animal’s immune system, the virus can be lethal. The disease caused by this virus is a form of cancer of blood cells called lymphocytes (a leukemia).

Cats infected with FeLV can serve as sources of infection. Cats pass the virus between themselves through saliva and close contact, by biting another cat, through a litter box or food dish used by an infected cat (rarely happens), and from milk during nursing. Transmission can also take place from an infected mother cat to her kittens, either before they are born or while they are nursing.

The signs and symptoms of infection with feline leukemia virus are quite varied and include loss of appetite, poor coat condition, infections of the skin, bladder and respiratory tract, oral disease, seizures, lymphadenopathy (swollen lymph nodes), skin lesions, fatigue, fever, weight loss, stomatitis, gingivitis, litter box avoidance, pancytopenia, poor grooming, reoccurring bacterial and viral illnesses, anaemia, diarrhoea, and jaundice (Wiki: Feline leukemia virus).
1. env from FeLV-A/Glasgow
  • Gene Name : env from FeLV-A/Glasgow
  • Sequence Strain (Species/Organism) : Feline leukemia virus
  • NCBI Protein GI : 546071
  • Other Database IDs : CDD:109485
  • Taxonomy ID : 11768
  • Gene Strand (Orientation) : ?
  • Protein Name : gp70
  • Protein Length : 445
  • Protein Note : ENV polyprotein (coat polyprotein); pfam00429
  • Protein Sequence : Show Sequence
    >gi|546071|gb|AAB30310.1| gp70=envelope protein {endogenous provirus} [feline leukemia virus FeLV, Glasgow-1 islolate, host=cat lymphoid tissues, Peptide, 445 aa]
    MESPTHPKPSKDKTLSWNLAFLVGILFTIDIGMANPSPHQIYNVTWVITNVQTNTQANATSMLGTLTDAY
    PTLHVDLCDLVGDTWEPIVLNPTNVKHGARYSSSKYGCKTTDRKKQQQTYPFYVCPGHAPSLGPKGTHCG
    GAQDGFCAAWGCETTGETWWKPTSSWDYITVKRGSSQDNSCEGKCNPLVLQFTQKGRQASWDGPKMWGLR
    LYRTGYDPIALFTVSRQVSTITPPQAMGPNLVLPDQKPPSRQSQTGSKVATQRPQTNESAPRSVAPTTMG
    PKRIGTGDRLINLVQGTYLALNATDPNKTKDCWLCLVSRPPYYEGIAILGNYSNQTNPPPSCLSIPQHKL
    TISEVSGQGLCIGTVPKTHQALCNKTQQGHTGAHYLAAPNGTYWACNTGLTPCISMAVLNWTSDFCVLIE
    LWPRVTYHQPEYVYTHFAKAVRFRR
  • Molecule Role : Protective antigen
  • Related Vaccine(s): ALVAC-FL- env/gag , FeLV DNA vaccine gag/pol and env
2. Env from strain FRA
  • Gene Name : Env from strain FRA
  • Sequence Strain (Species/Organism) : Feline leukemia virus
  • VO ID : VO_0011068
  • NCBI Gene ID : 1491868
  • NCBI Protein GI : 9630709
  • Locus Tag : FeLVgp2
  • Genbank Accession : AF052723
  • Protein Accession : NP_047256
  • Taxonomy ID : 11768
  • Gene Starting Position : 5987
  • Gene Ending Position : 7915
  • Gene Strand (Orientation) : ?
  • Protein Name : Env polyprotein
  • Protein pI : 8.36
  • Protein Weight : 67586.88
  • Protein Length : 642
  • DNA Sequence : Show Sequence
    >gi|9630707:5987-7915 Feline leukemia virus, complete genome
    GATGGAAAGTCCAACGCACCCAAAACCCTCTAAAGATAAGACTCTCTCGTGGAACTTAGCGTTTCTGGTG
    GGGATCTTATTCACAATAGACATAGGAATGGCCAATCCTAGTCCACACCAAATATATAATGTAACTTGGG
    TAATAACCAATATGCAAACTAACACCCAAGCTAATGCCACCTCTATGTTAGGAACCTTAACCGATGCCTA
    CCCTACCCTACATGTTGACCTATGTGACCTAGTGGGAGACACCTGGGAACCTATAGTCCTAGATCCAACC
    AATGTAAAACACGGGGCACGTTACTCCTCCTCAAAGTATGGATGTAAAACTACAGATAGAAAAAAACAGC
    AACAAACATACCCCTTTTACGTCTGCCCCGGACATGCCCCCTCGCTGGGGCCAAAGGGAACACATTGTGG
    AGGGGCACAAGATGGGTTTTGTGCCGCATGGGGATGTGAGACCACCGGAGAAGCTTGGTGGAAGCCCTCC
    TCCTCATGGGACTATATCACAGTAAAAAGAGGGAGTAGTCAGGACAATAGCTGTGAGGGAAAATGCAACC
    CCCTGATTTTGCAGTTCACCCAGAAGGGAAGACAAGCCTCTTGGGACGGACCTAAGATATGGGGATTGCG
    ACTATACCGTACAGGATATGACCCTATCGCCTTATTCACGGTGTCCCGGCAGGTGTCAGCCATTACGCCG
    CCTCAGGCAATGGGACCAAACCTAGTCTTACCTGATCAAAAACCCCCATCCAGACAATCCCAAACAGGGT
    CCAAAGTGGCGACCCAGAGGCTCCAAACGACTGAAAGCGCCCCAAGGTCTGTTGCCCCCACCACCGTGGG
    TCCCAAACGGATTGGGACCGGAGATAGGTTAATAAATTTAGTACAAGGGACATACCTAGCCTTAAATGCC
    ACCGACCCCAACAAAACTAAAGACTGTTGGCTCTGCCTGGTTTCTCGACCACCCTATTACGAAGGGATTG
    CAATCTTAGGTAACTACAGCAACCAAACAAACCCCCCCCCATCCTGCCTATCTACTCCGCAACACAAACT
    GACCATATCTGAAGTATCAGGGCAAGGACTGTGCATAGGGACTGTTCCTAAGACCCACCAGGCTTTGTGC
    AATGAGACACAACAGGGACATACAGGGGCGCACTATCTAGCCGCCCCCAATGGCGCCTATTGGGCCTGTA
    ACACTGGACTCACCCCATGCATTTCCATGGCGGTGCTCAATTGGACCTCTGATTTTTGTGTCTTAATCGA
    ATTATGGCCCAGAGTGACTTACCATCAACCCGAATATGTGTACACACATTTTGCCAAAGCTGTCAGGTTC
    CGAAGAGAACCAATATCACTAACTGTTGCCCTCATGTTGGGAGGACTCACTGTAGGGGGCATAGCCGCGG
    GGGTCGGAACAGGGACTAAAGCCCTCCTTGAAACAGCCCAGTTCAGACAACTACAAATGGCCATGCACAC
    AGACATCCAGGCCCTAGAAGAGTCAATTAGTGCCTTAGAAAAGTCCCTGACCTCCCTTTCTGAAGTAGTC
    TTACAAAACAGACGGGGCCTAGATATTCTATTCTTACAAGAGGGAGGGCTCTGTGCCGCATTAAAAGAAG
    AATGTTGCTTCTATGCGGATCACACCGGACTCGTCCGAGACAATATGGCTAAATTGAGAGAAAGACTAAA
    ACAGCGGCAACAACTGTTTGACTCCCAACAGGGATGGTTTGAAGGATGGTTCAACAAGTCCCCCTGGTTC
    ACAACCTTAATTTCCTCCATTATGGGCCCCTTACTAATCCTACTCCTAATTCTCCTCTTCGGCCCATGCA
    TCCTTAACAGATTAGTACAATTCGTAAAAGACAGAATATCTGTGGTACAAGCCTTAATTTTAACCCAACA
    GTACCAACAGATAAAGCAATACGATCCGGACCGACCATG
  • Protein Sequence : Show Sequence
    >gi|9630709|ref|NP_047256.1| Env polyprotein [Feline leukemia virus]
    MESPTHPKPSKDKTLSWNLAFLVGILFTIDIGMANPSPHQIYNVTWVITNMQTNTQANATSMLGTLTDAY
    PTLHVDLCDLVGDTWEPIVLDPTNVKHGARYSSSKYGCKTTDRKKQQQTYPFYVCPGHAPSLGPKGTHCG
    GAQDGFCAAWGCETTGEAWWKPSSSWDYITVKRGSSQDNSCEGKCNPLILQFTQKGRQASWDGPKIWGLR
    LYRTGYDPIALFTVSRQVSAITPPQAMGPNLVLPDQKPPSRQSQTGSKVATQRLQTTESAPRSVAPTTVG
    PKRIGTGDRLINLVQGTYLALNATDPNKTKDCWLCLVSRPPYYEGIAILGNYSNQTNPPPSCLSTPQHKL
    TISEVSGQGLCIGTVPKTHQALCNETQQGHTGAHYLAAPNGAYWACNTGLTPCISMAVLNWTSDFCVLIE
    LWPRVTYHQPEYVYTHFAKAVRFRREPISLTVALMLGGLTVGGIAAGVGTGTKALLETAQFRQLQMAMHT
    DIQALEESISALEKSLTSLSEVVLQNRRGLDILFLQEGGLCAALKEECCFYADHTGLVRDNMAKLRERLK
    QRQQLFDSQQGWFEGWFNKSPWFTTLISSIMGPLLILLLILLFGPCILNRLVQFVKDRISVVQALILTQQ
    YQQIKQYDPDRP
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Study describes experiments which demonstrate that the vaccine, (EURIFEL FeLV; Merial) that expresses the FeLV env and gag protective genes, is effective against any oronasal FeLV challenge. The protection was shown to be solid against an oronasal challenge one year after the initial vaccination, and was effective against a very severe 'in-contact' challenge (Poulet et al., 2003).
  • Related Vaccine(s): EURIFEL FeLV
3. Gag
  • Gene Name : Gag
  • Sequence Strain (Species/Organism) : Feline leukemia virus
  • VO ID : VO_0011069
  • NCBI Protein GI : 323916
  • Other Database IDs : CDD:110163
    CDD:111035
    CDD:128637
  • Taxonomy ID : 11768
  • Gene Strand (Orientation) : ?
  • Protein Name : gag-p15 polyprotein
  • Protein Length : 506
  • Protein Note : serogroup: B
  • Protein Sequence : Show Sequence
    >gi|323916|gb|AAA43055.1| gag [Feline leukemia virus]
    MGQTVTTPLSLTLDHWSEVRARAHNQGVEVRKKKWITLCEAEWVMMNVGWPREGTFSLDNISQVEKKIFA
    PGPHGHPDQVPYITTWRSLATDPPSWVRPFLPPPKPPTPLPQPLSPQPSAPLTSSLYPVVPKPDPPKPPV
    LPPDPSSPLIDLLTEEPPPYPGGHGPPPSGPRTPAASPIASRLRERRENPAEESQALPLREGPNNRPQYW
    PFSASDLYNWKSHNPPFSQDPVALTNLIESILVTHQPTWDDCQQLLQALLTGEERQRVLLEARKQVPGED
    GRPTQLPNVIDETFPLTRPNWDFATPAGREHLRLYRQLLLAGLRGAARRPTNLAQVKQVVQGKEETPAAF
    LERLKEAYRMYTPYDPEDPGQAASVILSFIYQSSPDIRNKLQRLEGLQGFTLSDLLKEAEKIYNKRETPE
    EREERLWQRQEERDKKRHKEMTKVLATVVAQNRDKDREENKLGDQRKIPLGKDQCAYCKEKGHWVRDCPK
    RPRKKPANSTLLNLED
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : The vaccine, (EURIFEL FeLV; Merial) that expresses the FeLV env and gag protective genes, is effective against any oronasal FeLV challenge. The protection was shown to be solid against an oronasal challenge one year after the initial vaccination, and was effective against a very severe 'in-contact' challenge (Poulet et al., 2003).
  • Related Vaccine(s): ALVAC-FL- env/gag , EURIFEL FeLV
III. Vaccine Information
1. ALVAC-FL- env/gag
a. Vaccine Ontology ID:
VO_0004740
b. Type:
Recombinant vector vaccine
c. Status:
Research
d. Host Species for Licensed Use:
Baboon
e. Gene Engineering of env from FeLV-A/Glasgow
  • Type: Recombinant vector construction
  • Description: Two ALVAC (canarypox virus)-based recombinant viruses expressing the feline leukemia virus (FeLV) subgroup A env and gag genes were assessed for their protective efficacy in cats. Both recombinant viruses contained the entire gag gene. ALVAC-FL also expressed the entire envelope glycoprotein, while ALVAC-FL(dl IS) expressed an env-specific gene product deleted of the putative immunosuppressive region (Tartaglia et al., 1993).
  • Detailed Gene Information: Click here.
f. Gene Engineering of Gag
  • Type: Recombinant protein preparation
  • Description: Two ALVAC (canarypox virus)-based recombinant viruses expressing the feline leukemia virus (FeLV) subgroup A env and gag genes were assessed for their protective efficacy in cats. Both recombinant viruses contained the entire gag gene. ALVAC-FL also expressed the entire envelope glycoprotein, while ALVAC-FL(dl IS) expressed an env-specific gene product deleted of the putative immunosuppressive region (Tartaglia et al., 1993).
  • Detailed Gene Information: Click here.
g. Preparation
Two ALVAC (canarypox virus)-based recombinant viruses expressing the feline leukemia virus (FeLV) subgroup A env and gag genes (Tartaglia et al., 1993).
h. Immunization Route
Intramuscular injection (i.m.)
i. Cat Response
  • Vaccination Protocol: Cats were vaccinated with ALVAC-FL(dI IS) or ALVAC-FL, consisting of two subcutaneous inoculations of 108 PFU at 5 and 2 weeks prior to challenge (Tartaglia et al., 1993).
  • Vaccine Immune Response Type: VO_0003057
  • Challenge Protocol: All cats were challenged by oronasal administration of 2 x 106 FFU of FeLV-A/Glasgow-1 isolate to simulate natural transmission (Tartaglia et al., 1993).
  • Efficacy: Although only 50% of the cats vaccinated with ALVAC-FL(dl IS) were protected against persistent viremia after oronasal exposure to a homologous FeLV isolate, all cats administered ALVAC-FL resisted the challenge exposure. Significantly, protection was afforded in the absence of detectable FeLV-neutralizing antibodies (Tartaglia et al., 1993).
2. EURIFEL FeLV
a. Tradename:
EURIFEL FeLV
b. Manufacturer:
Merial
c. Vaccine Ontology ID:
VO_0000918
d. Type:
Recombinant vector vaccine
e. Status:
Licensed
f. Host Species for Licensed Use:
Cat
g. Gene Engineering of Env from strain FRA
  • Type: Recombinant protein preparation
  • Description: Canarypox-based recombinant vaccine that expresses the FeLV env and gag protective genes (Poulet et al., 2003)
  • Detailed Gene Information: Click here.
h. Gene Engineering of Gag
  • Type: Recombinant protein preparation
  • Description: Canarypox-based recombinant vaccine that expresses the FeLV env and gag protective genes (Poulet et al., 2003)
  • Detailed Gene Information: Click here.
i. Vector:
Canarypox virus
j. Immunization Route
Intramuscular injection (i.m.)
k. Description
Canarypox virus-vectored vaccine
l. Cat Response
  • Challenge Protocol: Oronasal FeLV challenge
  • Efficacy: The vaccine, (EURIFEL FeLV; Merial) that expresses the FeLV env and gag protective genes, is effective against any oronasal FeLV challenge. The protection was shown to be solid against an oronasal challenge one year after the initial vaccination, and was effective against a very severe 'in-contact' challenge (Poulet et al., 2003).
3. Feline Immunodeficiency-Leukemia Virus Killed Virus Vaccine (USDA: 15D5.R0)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001841
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
4. Feline Leukemia Killed Virus Vaccine (USDA: 1555.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001545
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
5. Feline Leukemia Killed Virus Vaccine (USDA: 1555.21)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0001546
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
6. Feline Leukemia Killed Virus Vaccine (USDA: 1555.22
a. Manufacturer:
Pfizer, Inc.
b. Type:
Inactivated or "killed" vaccine
c. Status:
Licensed
d. Location Licensed:
USA
e. Host Species for Licensed Use:
Cat
7. Feline Leukemia Killed Virus Vaccine (USDA: 1555.R1)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001548
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
8. Feline Leukemia Live Canarypox Vector Vaccine (USDA: 1555.R3)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001549
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
9. Feline Leukemia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1A69.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001842
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
10. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001843
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
11. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Killed Virus Vaccine (USDA: 15B5.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001844
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
12. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001845
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
13. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia Modified Live & Killed Virus Vaccine (USDA: 15B9.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001846
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
14. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001847
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
15. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.23)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001848
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
16. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Killed Chlamydia Vaccine (USDA: 1559.2C)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0001849
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
17. Feline Leukemia-Rhinotracheitis-Calici-Panleukopenia-Chlamydia Psittaci Modified Live & Killed Virus, Modified Live Chlamydia Vaccine (USDA: 1559.2B)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001850
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Cat
18. FeLV DNA vaccine gag/pol and env
a. Vaccine Ontology ID:
VO_0004492
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Kitten
e. Gene Engineering of env from FeLV-A/Glasgow
  • Type: DNA vaccine construction
  • Description: Vector pUSE1 expressed two separate pUSE12 series constructs, one expressing FeLV gag/pol genes and the other expressing the FeLV subgroup A env gene (Hanlon et al., 2001).
  • Detailed Gene Information: Click here.
f. Vector:
pUSE1- is a mammalian expression vector derived from the vector pCI-neo (Promega) (Hanlon et al., 2001)
g. Immunization Route
Intramuscular injection (i.m.)
h. Cat Response
  • Vaccine Immune Response Type: VO_0000286
  • Efficacy: The vaccine consisting of FeLV DNA with the IL-12 and IL-18 genes conferred significant immunity, protecting completely against transient and persistent viremia, and in five of six kittens protecting against latent infection (Hanlon et al., 2001).
IV. References
1. Hanlon et al., 2001: Hanlon L, Argyle D, Bain D, Nicolson L, Dunham S, Golder MC, McDonald M, McGillivray C, Jarrett O, Neil JC, Onions DE. Feline leukemia virus DNA vaccine efficacy is enhanced by coadministration with interleukin-12 (IL-12) and IL-18 expression vectors. Journal of virology. 2001; 75(18); 8424-8433. [PubMed: 11507187].
2. Poulet et al., 2003: Poulet H, Brunet S, Boularand C, Guiot AL, Leroy V, Tartaglia J, Minke J, Audonnet JC, Desmettre P. Efficacy of a canarypox virus-vectored vaccine against feline leukaemia. The Veterinary record. 2003; 153(5); 141-145. [PubMed: 12934796].
3. Tartaglia et al., 1993: Tartaglia J, Jarrett O, Neil JC, Desmettre P, Paoletti E. Protection of cats against feline leukemia virus by vaccination with a canarypox virus recombinant, ALVAC-FL. Journal of virology. 1993; 67(4); 2370-2375. [PubMed: 8383248].
4. Wiki: Feline leukemia virus: Feline leukemia virus [http://en.wikipedia.org/wiki/Feline_leukemia_virus]