VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Canine coronavirus

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. S (Protective antigen)
  3. Vaccine Information
    1. Canine Coronavirus Killed Virus Vaccine (USDA: 14P5.20)
    2. Canine Coronavirus Killed Virus Vaccine (USDA: 14P5.21)
    3. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47A5.20)
    4. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21)
    5. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20)
    6. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.21)
    7. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.24)
    8. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.23)
    9. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.25)
    10. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46E5.20)
    11. Canine Coronavirus Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46D5.27)
    12. Canine Coronavirus Modified Live Virus Vaccine (USDA: 14P1.20)
    13. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.20)
    14. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.21)
    15. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.22)
    16. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.25)
    17. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.29)
    18. Canine Coronavirus-Parvovirus Modified Live Virus Vaccine (USDA: 14R1.20)
    19. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.20)
    20. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.21)
    21. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.25)
    22. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.29)
    23. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.20)
    24. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.29)
    25. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21)
    26. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.25)
    27. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.29)
    28. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47L9.20)
    29. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.21)
    30. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.26)
    31. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.27)
    32. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.20)
    33. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.22)
    34. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.20)
    35. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46L9.27)
    36. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.R1)
    37. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus; Canarypox Vector Vaccine (USDA: 1591.R1)
    38. Canine Distemper-Adenovirus Type 2-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46P9.27)
    39. Canine Distemper-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14D7.20)
    40. Canine Distemper-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14D9.27)
    41. RECOMBITEK Corona MLV
  4. References
I. General Information
1. NCBI Taxonomy ID:
11153
2. Disease:
Intestinal disease
3. Introduction
Canine coronavirus is a virus of the family Coronaviridae that causes a highly contagious intestinal disease worldwide in dogs. It was discovered in 1971 in Germany during an outbreak in sentry dogs. The virus invades and replicates in the villi of the small intestine. Intestinal disease may be related to virus-induced apoptosis (programmed cell death) of cells of the epithelial mucosa of the small intestine. Canine coronavirus was originally thought to cause serious gastrointestinal disease, but now most cases are considered to be very mild or without symptoms. A more serious complication of canine coronavirus occurs when the dog is also infected with canine parvovirus. Coronavirus infection of the intestinal villi makes the cells more susceptible to parvovirus infection. This causes a much more severe disease than either virus can separately. However, fatal intestinal disease associated with canine coronavirus without the presence of canine parvovirus is still occasionally reported. This may be related to the high mutation rate of RNA positive stranded viruses, of which canine coronavirus is one.

The incubation period is only one to three days. The disease is highly contagious and is spread through the feces of infected dogs, who usually shed the virus for six to nine days, but sometimes for six months following infection. Symptoms include diarrhea, vomiting, and anorexia. Diagnosis is through detection of virus particles in the feces. Treatment usually only requires medication for diarrhea, but more severely affected dogs may require intravenous fluids for dehydration. Fatalities are rare (Wiki: Canine coronavirus).
1. S
  • Gene Name : S
  • Sequence Strain (Species/Organism) : Canine coronavirus
  • NCBI Protein GI : AGE32061
  • Taxonomy ID : 11153
  • Protein Name : spike glycoprotein
  • Protein pI : 4.39
  • Protein Weight : 13725.702
  • Protein Length : 189
  • Protein Note : pantropic;
    biotype: CCoV-IIa; genotype: CCoV-II
  • Protein Sequence : Show Sequence
    >AGE32061.1 spike glycoprotein, partial [Canine coronavirus]
    IVLETCILLLCSYHTVXSTTNNDCRQVNVTQLPGNEYLIRDFLFQNFKEEGSEVVGGYYPTEVWYNCSRT
    ATTTAYEYFNNIHAFYFDMEAMENSTGNARGKPLLFHVHGDPVSVIIYISAYRDD
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Qiao et al., 2005)
III. Vaccine Information
1. Canine Coronavirus Killed Virus Vaccine (USDA: 14P5.20)
a. Manufacturer:
Wyeth, Intervet Inc., Pfizer, Inc., VacciCel, Inc.
b. Vaccine Ontology ID:
VO_0001743
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
2. Canine Coronavirus Killed Virus Vaccine (USDA: 14P5.21)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001744
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
3. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47A5.20)
a. Manufacturer:
Wyeth, Boehringer Ingelheim Vetmedica, Inc.
b. Vaccine Ontology ID:
VO_0002239
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
4. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 47E5.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002244
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
5. Canine Coronavirus Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 47E5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002243
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
6. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002222
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
7. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46E5.24)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002224
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
8. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.23)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002223
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
9. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46E5.25)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002225
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
10. Canine Coronavirus Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46E5.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002221
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
11. Canine Coronavirus Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46D5.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002220
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
12. Canine Coronavirus Modified Live Virus Vaccine (USDA: 14P1.20)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0001745
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
13. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002122
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
14. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.21)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002123
c. Type:
Live vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
15. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.22)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002124
c. Type:
Live vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
16. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.25)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002125
c. Type:
Live vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
17. Canine Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14R7.29)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002126
c. Type:
Live vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
18. Canine Coronavirus-Parvovirus Modified Live Virus Vaccine (USDA: 14R1.20)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0002121
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
19. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.20)
a. Manufacturer:
Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002136
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
20. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.21)
a. Manufacturer:
Wyeth, Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002137
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
21. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.25)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002138
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
22. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 1599.29)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002139
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
23. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.20)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002241
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
24. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin (USDA: 47C5.29)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002242
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
25. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Borrelia Burgdorferi Bacterin-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46B9.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002219
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
26. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.25)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002231
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
27. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterial Extract (USDA: 46J9.29)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002234
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
28. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Grippotyphosa-Icterohaemorrhagiae-Pomona Bacterin (USDA: 47L9.20)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002246
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
29. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.21)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002230
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
30. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.26)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002232
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
31. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterial Extract (USDA: 46J9.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002233
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
32. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.20)
a. Manufacturer:
Intervet Inc., Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002226
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
33. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J7.22)
a. Manufacturer:
Pfizer, Inc.
b. Vaccine Ontology ID:
VO_0002227
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
34. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002229
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
35. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46L9.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002236
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
36. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus, Live Canarypox Vector Vaccine-Leptospira Canicola-Icterohaemorrhagiae Bacterin (USDA: 46J9.R1)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0002235
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
37. Canine Distemper-Adenovirus Type 2-Coronavirus-Parainfluenza-Parvovirus Modified Live Virus; Canarypox Vector Vaccine (USDA: 1591.R1)
a. Manufacturer:
Merial, Inc.
b. Vaccine Ontology ID:
VO_0002135
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
38. Canine Distemper-Adenovirus Type 2-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine-Leptospira Icterohaemorrhagiae Bacterial Extract (USDA: 46P9.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002237
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
39. Canine Distemper-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14D7.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002117
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
40. Canine Distemper-Coronavirus-Parvovirus Modified Live & Killed Virus Vaccine (USDA: 14D9.27)
a. Manufacturer:
Wyeth
b. Vaccine Ontology ID:
VO_0002118
c. Type:
Live, attenuated vaccine; Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Gray wolf
41. RECOMBITEK Corona MLV
a. Tradename:
RECOMBITEK Corona MLV
b. Manufacturer:
Merial
c. Vaccine Ontology ID:
VO_0000923
d. Type:
Live, attenuated vaccine
e. Status:
Licensed
f. Host Species for Licensed Use:
Dog
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
Modified live virus(Pardo et al., 1999)
IV. References
1. Pardo et al., 1999: Pardo MC, M. Mackowiak. Efficacy of a new canine-origin, modified-live virus vaccine against canine coronavirus. Canine Practice. 1999; 24; 6-8.
2. Qiao et al., 2005: Qiao J, Xia XZ, Yang ST, Hu GX, Xie ZJ. [Construction of recombinant canine adenovirus type 2 expressing Canine coronavirus spike glycoprotein and its immunogenicity]. Wei sheng wu xue bao = Acta microbiologica Sinica. 2005; 45(4); 588-592. [PubMed: 16245877].
3. Wiki: Canine coronavirus: Canine coronavirus [http://en.wikipedia.org/wiki/Canine_coronavirus]