VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Yersinia ruckeri

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. aroA (Virmugen)
  3. Vaccine Information
    1. AquaVac ERM
    2. Yersinia ruckeri aroA mutant vaccine
  4. References
I. General Information
1. NCBI Taxonomy ID:
29486
2. Disease:
Enteric redmouth disease
3. Introduction
Yersinia ruckeri is the causative agent of yersiniosis or enteric redmouth disease leading to significant economic losses in salmonid aquaculture worldwide. Infection may result in a septicaemic condition with haemorrhages on the body surface and in the internal organs. Despite the significance of the disease, very little information is available on the pathogenesis, hampering the development of preventive measures to efficiently combat this bacterial agent (Tobback et al., 2007).
1. aroA
  • Gene Name : aroA
  • NCBI Protein GI : 15420539
  • Other Database IDs : CDD:179423
    CDD:30129
  • Taxonomy ID : 29486
  • Gene Strand (Orientation) : ?
  • Protein Name : 5-enolpyruvylshikimate-3-phosphate synthase
  • Protein Length : 427
  • Protein Note : 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional
  • Protein Sequence : Show Sequence
    >gi|15420539|gb|AAK97382.1|AF360730_1 5-enolpyruvylshikimate-3-phosphate synthase [Yersinia ruckeri]
    MLESLTLQPIALINGTVNLPGSKSVSNRALLLAALAEGTTRLHNLLDSDDIRHMLNALKSLGVNYRLSAD
    RTQCDVDGLGGPLVADKTLELFLGNAGTAMRPLAAALCLGYSDIVLTGEERMKERPIGHLVDALEGGAQI
    DYLEQENYPPLRIRGGFRGGELTVDGSVSSQFLTALLMAAPLATQDTHIRIQGDLVSRPYIDITLHLMRS
    FGVEVTHQNYQVFHIQGGQTYHSPGEYLVEGDASSASYFLAAAAIKGGTVRVTGIGKKSVQGDTKFADVL
    EKMGAIIHWGDDYIECSRGELRDIDMDMNHIPDAAMTIATAALFAKGPTIIRNIYNWRVKETDRLSAMAT
    ELRKVGAEVEEGQDYIRVVPPAHLIAAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQL
    ARLSVLA
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An aroA mutant is highly attenuated in rainbow trout and induces significant protection from challenge with wild type Y. ruckeri (Temprano et al., 2005).
  • Related Vaccine(s): Yersinia ruckeri aroA mutant vaccine
III. Vaccine Information
1. AquaVac ERM
a. Tradename:
AquaVac ERM
b. Manufacturer:
Schering-Plough Animal Health
c. Vaccine Ontology ID:
VO_0000842
d. Type:
Inactivated or "killed" vaccine
e. Status:
Licensed
f. Host Species for Licensed Use:
Fish
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
Killed oral vaccine
2. Yersinia ruckeri aroA mutant vaccine
a. Vaccine Ontology ID:
VO_0002948
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Rainbow trout
e. Gene Engineering of aroA
f. Immunization Route
Intraperitoneal injection (i.p.)
g. Rainbow trout Response
IV. References
1. Temprano et al., 2005: Temprano A, Riaño J, Yugueros J, González P, de Castro L, Villena A, Luengo JM, Naharro G. Potential use of a Yersinia ruckeri O1 auxotrophic aroA mutant as a live attenuated vaccine. Journal of fish diseases. 2005; 28(7); 419-427. [PubMed: 16083447].
2. Tobback et al., 2007: Tobback E, Decostere A, Hermans K, Haesebrouck F, Chiers K. Yersinia ruckeri infections in salmonid fish. Journal of fish diseases. 2007; 30(5); 257-268. [PubMed: 17501736].
3. Yang et al., 2009: Yang H, Chen J, Yang G, Zhang XH, Liu R, Xue X. Protection of Japanese flounder (Paralichthys olivaceus) against Vibrio anguillarum with a DNA vaccine containing the mutated zinc-metalloprotease gene. Vaccine. 2009; 27(15); 2150-2155. [PubMed: 19356619].