VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Mycoplasma gallisepticum

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
    4. Microbial Pathogenesis
    5. Host Ranges and Animal Models
  2. Vaccine Related Pathogen Genes
    1. TM-1 (Protective antigen)
    2. lpd (Virmugen)
  3. Vaccine Related Host Genes
    1. IgG Fc fragment
  4. Vaccine Information
    1. Avian Encephalomyelitis-Fowl Pox-Mycoplasma Gallisepticum Live Fowl Pox Vector, Live Virus Vaccine (USDA: )
    2. Fowl Pox-Mycoplasma Gallisepticum Live Fowl Pox Vector Vaccine (USDA: 1D51.R0)
    3. M. gallisepticum TM-1 Protein Subunit Vaccine
    4. Mycoplasma Gallisepticum Live Culture Vaccine (USDA: 1751.00)
    5. Mycoplasma Gallisepticum Live Culture Vaccine (USDA: 1751.01)
    6. Mycoplasma gallisepticum lpd mutant vaccine
    7. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B5.10)
    8. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B6.10)
    9. Porcine Rotavirus Modified Live Virus Vaccine-Clostridium Perfringens Type C-Escherichia Coli Bacterin-Toxoid (USDA: 49C1.21)
    10. Porcine Rotavirus Modified Live Virus Vaccine-Escherichia Coli Bacterin (USDA: 49K1.20)
    11. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Bordetella Bronchiseptica-Clostridium Perfringens Type C-Erysipelothrix Rhusiopathiae-Escherichia Coli-Pasteurella Multocida Bacterin-Toxoid (USDA: 49T9.21)
    12. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Clostridium Perfringens Type C-Escherichia Coli Bacterin-Toxoid (USDA: 49B1.21)
    13. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Escherichia Coli Bacterin (USDA: 49P1.20)
    14. Vaxsafe MG
  5. References
I. General Information
1. NCBI Taxonomy ID:
2096
2. Disease:
Chronic respiratory disease
3. Introduction
Mycoplasma gallisepticum (MG) is a bacterium belonging to the class Mollicutes and the family Mycoplasma. It is the causative agent of chronic respiratory disease (CRD) in chickens and infectious sinusitis in turkeys, chickens, game birds, pigeons, and passerine birds of all ages. MG is transmitted through the eggs of carrier hens. Most commercial flocks are MG free, however, and the disease is most frequently introduced from carrier birds being brought into the flock. Stress is thought to lower the poults resistance to the disease, like in CRD. Symptoms of infectious sinusitis for turkeys include watery eyes and nostrils and the area under the eye may be swollen. One may find airsacculitis with yellow exudates in the air sacs. Chickens may have no outward symptoms or there may be a sticky nasal discharge, airsacculitis, coughing, difficult breathing, swelling of the face, sneezing, a foamy secretion in the eyes, and a drop in food consumption. Egg production may be far below normal and there may be a drop in body weight as well. In CRD of young poultry, symptoms include rattling, sniffling, and sneezing. In older birds, conditions may go unnoticed. Worse conditions may exhibit nasal discharge or foamy secretion from the eyes. Lack of appetite, trouble breathing and a drop in egg production are also symptoms.The birds will also be stunned and unthrifty (Wiki: Mycoplasma gallisepticum).
4. Microbial Pathogenesis
The epithelium of the upper air passages is most susceptible to infection; however, in severe, acute disease the infection is also found in the lower respiratory tract. There is a marked interaction between respiratory viruses, Escherichia coli , and M. gallisepticum in the pathogenesis of chronic respiratory disease. Once infected, birds remain carriers for life (Merck Vet Manual: M. gallisepticum).
5. Host Ranges and Animal Models
M. gallisepticum infection is commonly designated as chronic respiratory disease in chickens and as infectious sinusitis in turkeys. Infection may also be seen in pheasants, chukar partridges, and peafowl. Infection in pigeons, quail, ducks, geese, and psittacine birds should be considered. Passerine-type birds are quite resistant, although M. gallisepticum is the major cause of natural outbreaks of conjunctivitis in wild house finches (Carpodacus mexicanus) in the eastern USA (Merck Vet Manual: M. gallisepticum).
1. lpd
  • Gene Name : lpd
  • Sequence Strain (Species/Organism) : Mycoplasma gallisepticum str. R(low)
  • NCBI Gene ID : 1089767
  • NCBI Protein GI : 31544686
  • Locus Tag : MGA_0161
  • Genbank Accession : AE015450
  • Protein Accession : NP_853264
  • Taxonomy ID : 710127
  • Gene Starting Position : 667939
  • Gene Ending Position : 669342
  • Gene Strand (Orientation) : -
  • Protein Name : dihydrolipoamide dehydrogenase (E3) component of pyruvate dehydrogenase complex
  • Protein pI : 7.54
  • Protein Weight : 47042.25
  • Protein Length : 467
  • Protein Note : MGA_0161; Lpd [C] COG1249 Dihydrolipoamide dehydrogenase/glutathione oxidoreductase and related enzymes; PRK06416, dihydrolipoamide dehydrogenase; MGRL526
  • DNA Sequence : Show Sequence
    >gi|294660180:667939-669342 Mycoplasma gallisepticum str. R(low) chromosome, complete genome
    TTTAGTGTTTTTTGTTGAAGTGGTTATAAATTGCTTGTTTAGCACATTCTGAGATGATTTCAGCAATTGT
    TGGGTGTGGGTGAATTGCTTGTTCTAATTCGAACACTGTTAGTTCATTTTCCATTGCTAAAGCAATTTCA
    GAGATCATATCACTAGCAGTAGAAGCAATCAAGACACATCCTAAGATCTCACCATACTTCTTACCGAACA
    TGAATTTAATGAATCCTTCAGTTGAACCATCAGCAATCGCTTTACCATTAACTGCCATTGGCATCTTAGA
    AACCACATATTCAATGTTCTTTTCTTTTAATTGTTGTTCAGTATAACCAATTGTTGCGATCTCTGGGTAA
    GTATAAATACATCCAGGAGTGGTTAGTGAACTTAATTTCTTTGTCTTACGATTTAAGATCGTATCAACAG
    CATATAATGCTTGGTGGTACGCATAATGAGCTAGCATGATCTGACCAGCAGCATCACCAATCACATAGAT
    TGAATCAGTTGAAGTTTGTAACTTGTCGTTTAATTTAATGCGGTTGCGATCATCTCTTGCTACGTTGAAT
    GATCCAAAAACTTGATCATTAACTACCCGACCAACTGATTCTAGGATATATTGAGAAGGTAGTTGGTAAG
    CTGTGCCATTATCTTCATAGATAATTGCGTTGTTTTGGTAACCTAAAATCTTGGCATTATAAACAACATT
    AACGCCTAATGATTTCATGCGTTTAGCAATGAAATCACTTGCATCTTGATCTAATAATTCGCATAAACGA
    TCAACAGCTTGTAAGATCGTTACTTTAGTACCTAATGAAGCGTATAACATCGCAAATTCGATCCCAATTA
    CACCCCCACCGATCACAACTAATGATTGAGGGATTTGTGGTAATTCAAGTGCTTTAGTTGACTCAATGAT
    CACACCTTCAGCACGACCTTGGTCAAACCCTGGAAGTGGTAATTTTCTTGGTGAAGAACCAGTGGCAACG
    ATAATATCTTTTGTTGTAATGTAAAATGTTTGGTTGTTTACAGTTACTGTATGACCATCAACAATTCTAG
    CTTCACCTACGATCGTATCAGCTTTAGCTACTTTTAAGATCGTTTTTACCCCGTTAACTAGCTTATTAAC
    AACAGCTTCTTTTCTTTTTAAGATATTTGCTCAGTTAACAGATAATTGATTATTAACTAAATCTAGTCCG
    TATTCAGCTGCTTTTTCAATGTAGTGTTTAACTTTAGAAGATTGTAGTAATGTTTTAGTTGGAATACAAC
    CAACATTTAAACAAACCCCACCATAAGTTCCACGTTCAATTACTAAAGTTTTAAGACCGTTTTTTGCAGC
    ATGTTCACCAGCTACATAACCACCAGGTCCAGCACCGATAACAATTAGATCGTAATTATACATATTAAGT
    ACCA
  • Protein Sequence : Show Sequence
    >gi|31544686|ref|NP_853264.1| dihydrolipoamide dehydrogenase (E3) component of pyruvate dehydrogenase complex [Mycoplasma gallisepticum str. R(low)]
    MVLNMYNYDLIVIGAGPGGYVAGEHAAKNGLKTLVIERGTYGGVCLNVGCIPTKTLLQSSKVKHYIEKAA
    EYGLDLVNNQLSVNWANILKRKEAVVNKLVNGVKTILKVAKADTIVGEARIVDGHTVTVNNQTFYITTKD
    IIVATGSSPRKLPLPGFDQGRAEGVIIESTKALELPQIPQSLVVIGGGVIGIEFAMLYASLGTKVTILQA
    VDRLCELLDQDASDFIAKRMKSLGVNVVYNAKILGYQNNAIIYEDNGTAYQLPSQYILESVGRVVNDQVF
    GSFNVARDDRNRIKLNDKLQTSTDSIYVIGDAAGQIMLAHYAYHQALYAVDTILNRKTKKLSSLTTPGCI
    YTYPEIATIGYTEQQLKEKNIEYVVSKMPMAVNGKAIADGSTEGFIKFMFGKKYGEILGCVLIASTASDM
    ISEIALAMENELTVFELEQAIHPHPTIAEIISECAKQAIYNHFNKKH
  • Molecule Role : Virmugen
  • Molecule Role Annotation : An lpd mutant is highly attenuated in chickens and induces significant protection from challenge with wild type M. gallisepticum (Gates et al., 2008).
  • Related Vaccine(s): Mycoplasma gallisepticum lpd mutant vaccine
2. TM-1
  • Gene Name : TM-1
  • Sequence Strain (Species/Organism) : Mycoplasma gallisepticum
  • VO ID : VO_0011178
  • NCBI Protein GI : 7249262
  • Other Database IDs : CDD:114418
  • Taxonomy ID : 2096
  • Gene Strand (Orientation) : ?
  • Protein Name : TM-1
  • Protein Length : 271
  • Protein Note : Mycoplasma haemagglutinin; pfam05692
  • Protein Sequence : Show Sequence
    >gi|7249262|gb|AAB28343.2| TM-1 [Mycoplasma gallisepticum]
    MNKKRIILKTISLLGTTSFLSIGISSCMSITKKDANPNNGQTQLQAARMELTDLINAKARTLASLQDYAK
    IEASLSSAYSEAETVNNNLNATLEQLKMAKTNLESAINQANTDKTTFDNEHPNLVEAYKALKTTLEQRAT
    NLEGLASTAYNQIRNNLVDLYNNASSLITKTLDPLNGGMLLDSNEITTVNRNINNTLSTINEQKTNADAL
    SNSFIKKVIQNNEQSFVGTFTNANVQPSNYSFVAFSADVTPVNYKYARRTVWNGDEPSSRI
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : An antiserum raised in chicken against the TM-1 polypeptide, which was produced by recombinant Escherichia coli cells and purified by column chromatography, inhibited growth of M.g. cells in vitro. Moreover, chickens immunized with this 29 kDa polypeptide (TM-1) were partially protected from a challenge with virulent M.g (Saito et al., 1993).
  • Related Vaccine(s): M. gallisepticum TM-1 Protein Subunit Vaccine
1. IgG Fc fragment
  • Gene Name : IgG Fc fragment
  • Sequence Strain (Species/Organism) : Gallus gallus
  • NCBI Gene ID : 424904
  • Taxonomy ID : 9031
  • Chromosome No : 9
  • Gene Starting Position : 12628992
  • Gene Ending Position : 12700391
  • Gene Strand (Orientation) : -
  • Protein Name : Fc fragment of IgG binding protein
  • DNA Sequence : Show Sequence
    >gi|358485503:12628992-12700391 Gallus gallus breed Red Jungle fowl, inbred line UCD001 chromosome 9, Gallus_gallus-4.0, whole genome shotgun sequence
    TGCAATTATTTATTTATTATTCTGAAAGTGTTAGAAATATTATTAAAATACAAGAGCAGAAAGTAATACG
    TATGAATTGGGGGGAAAAAAACAACACATACAGACACAGAAAAACACACTAACTACAGGTATGTACTTTG
    GGGTTCATCTTGGTCAAATGCAGCGTTCACTACGTAGCCATAATTGTGTTCCCGTACTCTGTCACCTGAT
    GAATCCTCAGACTCGTGCAAAGATGAATTCCGTGCATTGATGTTGGCATCTGCCTTTCTCCTCCTTCTGT
    ACACAAACAAACAAACAAACACCAACAACCATCTTTAATTTCTTATCTGGTCAAACGGTGGTGTGAGTGT
    GTGTGTCAGATTCCAAAGAATTCTAAGTTTTGTGGTAGTGGTGCATATGCATTATGTAATAGGAATGGCA
    CATCTTCATTCCTGTAGAAGAAAGCTTTCCCTCGTGTTCCTTAAATGATATCTTGAACGCTGTACTTCCT
    TTCTGATTCTGCAGGTGTGGGAATAGAGGAGTTTGGGGGTGTACAGAAGCCAAAATGAGTGTCTTGCCCT
    TGCTGAATGTAGCAAAGCTGGGAATAGTCTTACCTGAACAGATACACTGCAGAGGTGATGAGAATGACAA
    CGGCAACCACTGCTACTGTAACTCCAACAGCGATGGCAACTGTATTGCTCTGAGAACTCTCTGGGATACT
    TGTGTCATCTGAAGGAGAAAGGAGCCCGGTCACTATAAGCTAAGAGCACTGAGAACAGAAGATTCTCCTC
    AATTCCAAGTGTGAAACTGCACTGTGTGGAATCTGAACAGGAAGCAGACGTGCCTGTCTGCTTGGTTTAT
    ACTGTGTTGTCTGACTTAACTGGCTTTCTGGAATGGTGTCAGACCAAGGTCCTGTATGCCCTGCAGAGCC
    CTGCTGTCTTGCCTTCTAATACCTCTGTGCTGAGGACCTGCCCCCTTCTTTCTGTTTGAACATACCAGTA
    CCAACATGACCACCCAGCTTGTGGTACAAGGCCCAGTTTTTACTTGAAGGAATAGTGCCACTGAATTGGT
    TGGAAAGTGTAGTGGAATATTTCTAGTGTCAGCCTCCACTCTGCCCATGACTAAAATACAATCTGCCCTT
    GAAAAGATGTGATGAGGTCCCAGACTGATCTGACACCCCCTCCCAGTGGGTTACTTATTGATTCACAGCA
    TGGCAATTAAAAGCCAGCTCAGTCTTCTCCATAATGACACATTTTTTTTTTTTTATAGTGGTGTGTGTAA
    TTCAGGCAGAGAAATCCAGAGTAGTTTTATTACCTATCCTTTCAATATTGCATCTTTGTCCCATGTACAG
    CTCTGTACATTCACAGTAGTAGTTATCAGAGGTGTCATTGGTTGTTTCAGAGCAAATTCCATCATTCTGG
    CAAGGACTTGGCATACACGGTCCACCTAACAAAAAGGAAGGAGAAACACATCAGAATCTCATGTAATCCA
    GCCCTGAGAGAACTACTCTTGGTTAGATTACACTGCTACTGCTGGACGTGCCCTGTGTTTTAAGGCCTGT
    TATTTATTTTGTACTTGATAACAGGAGTATGGGAAAGAAACAAAGTTCTCCAGTAAGCTTATAAAGAAAG
    CTTATTATTTCTTCTGTTCAGACTGTTGCAACCCCAGACCCAGACACATCCTATAAGCAGTAACTCAAGA
    CTTCTTAGCAGCGAAGGAAAACACGATAGGTTTAGTGGTTCACTTACTCCTGTAGCACCCACGAGTGTAG
    TTTGCAATGTTACAGATTTCATCAGAACCACACAGTATGTTAGAGCAGGTGACAGTGGAGCTCTCTGTGC
    ACTGGCATTTCTGGGAGCAGTCATCAGTGGTGAACACCTCTCCAATCTGGAAGATAGCAAGTGAATGTTA
    AAAGATATCCAAATCAGGCAGGGAAACGTGAATGGAACACTGGAGCCCCATGCTACTCCGATTCTTCCTG
    ATGAATGACAACATGGCAGATCTCTCTTTTTTGTACTTTGAATACAGAAAGCAAGCAAGCAGCTCATTAA
    CCCATCTCCTTGAAACTCAAGGAATTTTGATGAAAATTTGAGGTGTGAGATCCCAGACCCAGGTTGGGTA
    TATGGACAACCAACAATATCTAACTGTTGCAGGAGATAAAGTGGCAAATGCATCATATTGTGCCTCCAAG
    ACGATGTGCAAAGGTGCCATGTGTCATTTCTCTGGCAAGCCCCATTTGTTTAGAGTGTCTACCTCCTCCC
    ATAACACCACCTTTACTTGCTTTAGGCCTTCTCTGTATCAAACCTCCAGTGCTGAATTGACTACAAAGCT
    TTTTATCCCACAGCTGGAAGGGTGGAATCTCTGGATTCCTCAGAATCCAGCCTTGCCGGAGGCTCTCTTC
    ATGCTGCAGCCAGCATTACAGACTCTCAGCCCCTCCTGTGCCACTCTTCACTGAGAGGAGAGGGACCATG
    GTGACCAGTAGAATTTTTCTATAACTGGCGTATTGTAAATTTTAGAGCCTATTGTGGCTGTTTACTGTAA
    TAAGGGTGAAGAATTAACAAGGAGGTCAGAGTGTAATCATATGCTTCCCCCAAGTGCCTGCAGAGTATTC
    TGACAGGCAGAGTTTCAGAGGCAGACTGACTCATGTATTCTCTCCTCCCTTCCTCCAGAGACCAGAATAT
    TATTAAATAAATTGCTCTTTGTTTCTAATGCAAAGTTACATGCTGAGGAGAACAAAGAGATTATCAAAAT
    AATTAGCACAAGAAAATATTGTTTAGCACTGCGGGAGCTGTCTGGCCTGCTGAGACACTGTACCTCATAA
    TATTTGTCAAGGTATGTGCAGCCACATTCTCTGTAAGGCACACATTCAGAGTCACTAAGAACATAGCCAG
    GGAGACATTCACAGCCTTCAACACAAGGCGATTCACACTCAGAGGGGCTGGTCATGTCGCTGCAGGATGC
    TGGGCAAGCAGTCATGCATGAGTTGTATTTGCTGTTGGGTGGACACGACATCTCTGTAAGAATAAGGAGA
    GTCCAGTTATAACAGGTTGCTGCTACACATTGCCTTTTCAGAGCTGTTTTGTAAGGGCAAAATGATGAAC
    ACACATACATAGAAATGTTCACATGTATATAATGGTAATGAAGTTATAAGTGAATAACTTGAAAATAAGG
    AAATGCATTCTCAAAGCTATGCATATGCAGTGCTCTGAGTCCAGGTGTTCACTAATATCAAATTACTTCT
    CACACATACAGAGTAGCTATCACTGAAAGCATCAGAGTAGTTTCACAGCTCTGAGAAGTGCGTTTCATCA
    GAAATACAAAATCCTCTGCCCATGGGTGATGCAGGGTAAGTATGGCCTGGATAAACCTCTCAGCTTGGGA
    AAGAAAAGTTAGGAAAAAGAGGTTTGAGATTATTGTAAATCCTATTTTCACATTTTTCAGTCTGAAAGAC
    GAGTTGGGAATGGAGACATTTTATTTTTCTCACCGAACTTCTCATGGCAGGGGAGCTGACCGCTCTGCTC
    CCCTGAGCAGCTTTCTAAGGTGGAGTCTCATACAAAACATCAGCATAAGACTCAGAGGCAGTGACTGAAG
    AGCAAGTGTGCGTGCTAAACTATGAACGATGATTGAAGTGTGAATCAAAGTTTGTAAGACCTAAGAAGCT
    TTGACATACAGCTTCTAGCAAAAACCTCTAATCCCATATTTTGAGAGTCCTTTAGGCAGAAACCACACTT
    TCAATTTCTTCCTGTACTTACCACAAGCTGTCTGTTGCCTCCAGCCTTCCATATTGACTCCTTGCTCCTG
    ACAAGCCAGCACGTACTCCTTCAGATGGCGACATAACGTGTCAGCATCATCTTCTACACACATATCGAAG
    ATGCAGTTCCTATGTACAACATGAGAAAGCATTCATGCACTATACCTTTTATTTTTTGTTTGCTGCTGCT
    ACCTTCTCAACTTTGCCGATCATCTGAATAGCAGTGGCCTGATTTTCAGAGGCAGTGAGAACTGAGGTGA
    ATGGGATCTGCAAGTATACAGTAACTCAGAAAAATACAGCAGCCACTAGGAAAGTAAAACAGGCTGCCCA
    ACGAAATTCTAGAGTAAGGAGAAAAGTGGGCTTACATTAAGAATCAGGATATAGACCCTGAAGTCAGTGG
    TCCATTTGTTTGGTTTAAGGTACTTCCACATTCCTCTCGCAGCTAAGAGAGGCTTTGAAGTGAGCACCAC
    CTATCTTTGTGCATTACTTACAACTCTGAGAGTAAAGAAATCTGGTAGCTGCTTGGCCATTCTTTGACTG
    ATAATGAATGAATGATAAACCTAAGAATTTATCAACAGGTTTCATATGGTTCAAAACCAGGTGTGTATGA
    ACTGTGTACTTAGAAGGCCAGATGAACAGAAGGAACTTTCTTGCCAGTGCCATGTGAGTTATCCTTCACT
    AAACTGGTTTTTTGCACCGCTCTGTGAAAGACTGAAGAACTGTCACTGACAGCTTTAGTCTCTGCAGCTC
    TGACTTGAATACTGCATTTTACAAAACTACAATTGCTAAGAAGAACCTAATAGAGGCAGGTACTGACTGA
    ATTATCACTGAATGCGAATGAGAACTTTGAGCACAGTGGAAATTCCAGCCTACAGATATAATGTTCAATG
    CTGCTGCTTTAGGTAAAGAGGAAAGCTACTTTCTAGAGATAACAGAAAAGTGAAACTAAATAGAGAGAAA
    AACATATCTTGTTTTAAAAAACAAACAAACAAATATTGGGAACTAAACATATAACTAAGAGAAGCTCTGG
    GCCCAGTTCTCCAAAGACACTTACTGTCCTCTGCTCCTAGAAACTGAAGACGTACAGTTCTTACCAGAGA
    CAAGCTCCAAAATTGTTTTGGAAGTGCGGAGAAAAATTGCAGATTGCAGCAGACACTTACGTGGAATAGG
    GCTCTGGTGGGACTGCAGAATGACAATTTGCAAAAGGACCATCCAATGCAGTCAGAATTTGACACTTAGA
    AGTGCTGTTTTCTTGCATCAGCTTATTTTCACTGCAGCCTTGATAGAGCCCTGTATCTGGTTCCTCATCA
    GGCTCATCTTCCACAATGGTTTCTCGCCTGGAAATGAAATCATTATGAAACCACCAGATCTCTGTACATC
    CAGCACTCATAGCACTAATTTGCAAGTAACAGCATTTCTGCCTTTTGATAGAAGTGTCAGCTTATTTCTC
    TCTCAATATTTATACTGAATGTGAAATGAGTATATAAAGCAAATCAAAGATGTACTAGAATAATTCCTAC
    CATTTCAGAGATATATGAGTTTTTAAATAAAAAACAATAGATGTTGTTATCTCCATGGACATTCTATATG
    ACATAGGTTTCATCCAGGCCTCCTTCACCTAATCCATTCTATAATAATTGAATGCTAGGCAGCTGGAGTA
    GACCACCATTTATTGGAAGTATGTTCACTTTCACTGAAGAGCATGCCTGAAGTGTCAGAATTCTTCTGCA
    GGTATAGATTCCAGAGCCTCCCTATGCTCAACATTAGCCTACATGCTGCTTTCTACTATCCTGCTGGACA
    GGTTTTTGCAGCCAGATTATATCCTGAAATGAATACAATTCTATTCATGTACTGGAAAAAAACAAATAAT
    ACAGTAATTTCTGTTGGTGGTTAAGCTACTCAAAAACCTTTCAAAGCAAATTGAAAAGGTGGAAGGAGAG
    AAGAAAACTTAGTTCCTTGCTTCAGTGTTCTGTATGGACTAAATAGGGCAGTTTGGCCTGATCACAAATA
    TCACACTGATTTTTATTCAAAAGAATGTCCCAGGTTTTTTTTTTTTTTTTTTTTTTTGTACTAGCAAAAA
    ACACAATGTAGTCATGAAAGTAAGGAAGTTAGACACTTGAAAAATCTCTTCTGTGAGGAACTGTGAATTC
    ATCCTGATGGATTTTGAAGGTGCCTTCATGTTCCAAAGAGAAGGATGACACTGAATCAGGATCTGCCTGT
    CCATCCAGCAAATGATGCATTTAATCTTTGCCAGGACCCATGGGCTTGGCAGATACCTTATTTATCCCTG
    TGCTCTAGCTGTTGTAATGGCTGTGACTCCAAAGGAAGCTGAACTAGAGCAATGCACTGAGAGCTCAGTC
    CTGTTTTGGCAAGATGGAAAAGCACTGATATTTCACCTTAGTGTTGAGCAGGAAAAGTCCCCACATGCAG
    ACTAAGGGAAGAAGTAACAGAAACCTGACTGCATAGTTAGACCTGAATATTAACTATGGCTTAATTTCCT
    CACTTCCAGTTGCTGTGTTTGCTAGGGATATTAAGTAGAAAATTAGGTACCTGAATCGAGAGGTTCTTCT
    TTTCACAGGAACCTTCCAGCTCTCACCAAATGCATTCACATTCTTCAGCCAAACACCATCTGGGTTTGTG
    AAGTCATTTCTAGGTCTCCCGTCAAAGTCACCACACAAACCTTCTACTCTGTTGTTGTAGGTGTTGGCCA
    GCTTTATATCTAGGAAAGTTCAAAGGAAAAAAAATAGCCATTACAAAGAAATATTTTCTTCCGAGTATAT
    GGAGGAGGTGGAAAGAAGTGTGAAGTACTGAATTCCACTATTCAGACTACAGTTGGTAGTGTGATGAAGG
    ATTTGAAATCATCAGAAATACCATGGCTGCATTACATTGTAAATCAGGGGTAGCTCCACTTTGGATAGAG
    GAGGTAATGTGTTTTCAGCTTACATGAATGAGTTCTGTATGCATGATATGAAAGTCCTGATGAGAAACAC
    TAAAGAATGGGATTATCTGGAACACGCTTGAGAGGAAGCATGTAAAAGAATGCACTCTCAGTTGTTCAGC
    TTGAGGACCTCAGTCCTGTAACTGGGTTAAGCTGGGAAAGGGGCAGATCCAGACTTTTCCCCATCGTCCT
    GATCAGCAGCTTAAAGTAATTTGCTTTTGTTTCCATCACTCAGGCCTTACCTAACATTAAAAGTAGTAGA
    ACAGTCTGACTCCACATACAATTTCTCCTAAATTCAGATGGATCCAGATAGAGAAATGCCAACTTCCATG
    AGAAATAATTTTTGTTTCAGTTTTCTGGAAGTTCATGTCACAAAGAACCACAGACTTAAAGGGTGAAAAT
    TTCTAATTTTATCTTGGGTTTAGACCTACTTTGTAATGATAACATTTTTTGACATGGTGCATAAATATTC
    CTGCTGATTGTTTTAGTATCACTTACCTGCATTTTGATCACCATCGTAGCTCAGGTATAAGCCAAAATCT
    GTCTCCAGGTAAATTCTTGTTGTCCTCTGATATATACGAATACCATCATGGGGACGAACAGGGGCTCTCA
    CCCTTACACCATCCAACTAAAAGGGAAAGAATAAGTTAATACTTATAATACAAATTCGTATGTGGCTTTG
    ATGCAGGTAAATGCTACAAAAGAGCATTCCTCTTTTCTGGTTTTATGATAAATATATAAGATATTTTAAC
    CAGGTAAAAAATACAGTATTCCACTTTTAAAGTAACAAAATCATATATTAAGGAAAGTGATCTGGACACA
    GTGTTCTTACATCATTATCATTCCTGAGAGATTTCCAGTACTGAACAAAAATGCATGTATGAGCCCAAGT
    ATGCTATTATGGACCAACAAAGAGGACAGAAACTGAGTTTTGCCAGCATAATTCACACTTGTCCCTACCA
    CTGATCATATTTTATGTGGCTTTTTGGTAAGGTTTGGATATTTGGTATTTTATTCCTAGAAGTCCATTTA
    TTTATTCATTCTAACTAGAATCTATCTTTCACAGCTTTAGAAAAAAAGAACACAACTGAAATCACACTTT
    TGCTTGCCCCACAGTACTGCTGTAATAACACTGTTAGCTTTAATACTCTTTAGAACAATCCTTTAATTTA
    TCTGTTTTACTACAAAGGAGAACCTTTGTCTGTGCTCTGCAGTTAGTGAGAGACTTACCAGTATCTGCTT
    GCCTTGCCTGAATCGCACTTCGTGATTGTAAACGTTGATGATAATCTCTTTCAAGTAAGTAATGCGTCGG
    TTTAGACGAAGAGGATAGTTCACGCCTTCGACGCTGAACTGTGTCAGAGTATCAGGTAGGTCAGGGATGG
    TCTGAGTCAGAATATACGTGTATTTCCCTTGGAAGTGGTGCACCAAACCATCAAATGTGATATAATGTGG
    ATCGCCTATGATCCGGCACTTGCCAAAACCTAAAGAAAAAGAGTTTAATTGCCTTCCAACCTGAATGCAC
    GTACCAAATCTTATGCATAAATCTGCTTAATACAGTTTAGATATAAATAATTGCTGCTAACATGCAATCC
    TCTCAAAACAAAGACGGGTGCTCAGGCATCACCCTAGCAAATGGGTACTCAGACAGAAAGCCAACCAGAG
    AAACTTATTCTTCTGCTGAGAACCAGTGGGAACCAATAGAACTGAAGCACGGCATTAGGGTTTATTGCTT
    TTATAGGCACTAAGCTGCACACATCAGTCCTCTGCAGAGGAATGACTGCCACACAGGACGGCTTGCAGTG
    GGCTTGTAAAGATGTTGGTTTCATAATCCTCAGCAATATGATCATCTGATCATCAATACAGTAGGACCTA
    TGCCATCCTATTCTTGAAAATTCATGTGTAGAGGTGTTAGGCAACAAGCTACCAATTAAACTGTCCAATT
    TACAATGAGAACATGGGATTAACCATAACATAGCAGGGCTGACACCTCAATGTAAAAGCTTAGCCAAAGC
    AAGTACTGGATGAAAAGCACCAAGATTGGCTATTAAGTATCTGTTGTGATCTGCTCTGTCCTGTTTTGCC
    TTTATTTTTCATATTTTCAAATCAATATGCAGTGAAGAAAATAAAAAAGAATGCCAAAGGATTAATAGAT
    GTATATATTAGACTTTTATTTTTAGTAAATGCAGTGGATATATATATATATAATCTGCCAAGTTTCTAGA
    TGTACATAGATTTTCAAACTCTTGTTCTAATTCTCTCTACAAATTCCCTGTCTTGTACTGTAACTTTCTA
    TTCTGATAAATGAGGCCTTTTTTTGTACTTAATAATGTTTCATCAGTAGTCCTGTCAGACCTGTCTTTTC
    ATGTCGTAAGGGTTGGAAGTGACATGGAATAAAGAATGGACATTCACATCAATCCTCCTTCTCTAGTCTT
    CATGGAATAGCAGATGAAGATCTGCCTGCACATACCTGTTGGATTGCACTTGTATTTTCCACTTTTGATC
    AAGCAGGTTTCTTTAGAATCACATCCGTAACTCTGACATCTGATGACACCATTCTGCTGACATTGACATC
    TTTCGGTGCAGTGTGGAGTAATCCAGGTCTCCCCAGCCTGGACACAAATTGTGGTATGTTACCAAGGTGC
    TGAGCAATAGAAAGTCAGTAGCAAAACGAGTGGAGTCTGGCTAGGTGCATCCTGCTGGCCATTCCACAAC
    TGCTCAATCCAGGTGTAAACTTATCAAGAAGCTGGGGGGGGGGGGGGGCAATCTCAGTCCATTTATCTTC
    CACAAGGGAATTGGAACACATAACAGGAATAGGATATACCACCCAATTAACGCGGTCAACTTTCCAGTAT
    GTCTCAATTTTGGCTTCAAGGTGCAAACGACCACATTCGTGCATCCTCTACCAACTTAAGCCCATAGCTT
    TTGCTAAGCAAATGAAATGTATTTAAAATGGTAGACCCTGAAGACTTTTCTTTCTCATTCTGTTGGACAC
    AGAACCAATTTCCTGCAAGTTTTGCAGTCAGAAATTTACCCTACAATGGACTACTTACACTGTAGTAATT
    GTTGTCATCATCCCTGCAGCCACAGTTGCTGAGAGGAACACACTTGTCATTACTGAGCACATAATTATCA
    TCACACTCACAGCCCTCTGTGCATGATTCTGTCTTCTCACAAAGGGATGAGGCAAAAATGTCATTGCATG
    TTGATGGGCAGGCAGAGGCACAGGCTGTGTAATGGCTGTGGGATGGACAGGGCAATGCTGTGTGGGTGAA
    GAGAATAGAAGTAGTGTTATTAAACACGTTAAAACAAATGTTCTTGCCTGATATCTTCAACTTGGCCTGT
    AAAATAGTGGTGTAGTTCTGCCTTCTTATAGATCATTTTGATCATCAAACAAAAACTTTTTCTTCTTTTC
    TTTCTTTTTTTCATAATTAGATGGTAGCTTTGTTGAATGGATGGAGTGTGGCACATACAATGGAAATTAA
    TCCAAGAACTTGGCCCCTAATAAGCAACTGTCTGAATTGTCAGCAAGTGGCTTTGATCCCTGTGTTCAGT
    TCAGTTTCCCATTTGGTTTTTTACTTCTGGTTATACTACGGTTATTATAGTTGGACTTGATGATCTTGAA
    GATCTATTCCAACATAAATGATGCTGTGATTCTATTATTTCTCCATTTTAGACTCACTGCAGTATCTCAA
    GACATTCATTTGGCTACCAAAACCATTCTAGCTCCACACTATCACCCACAACTCATCTAGTTGTTATCAC
    TGGGTTTAGTTCAGCTTGCAAACAGTTCAGCAACATAGTCAAGTCATAAAATCATAACAACAGAATTGTT
    TATTTTGAATATTTTGTCTTAATTATCTTTTATATAACTTGTCTACCTAATACTGCTCATCTGTCTTATG
    CTGTCAGCCATCCAATTTTCTGTTTTTTTTCACTTTCTTTTGCACTTACGACAAAATGTGCTATTCCTCC
    ACGTGATGGTGATGCCTTGATTCCTGCAGGTGTCCACATAGAACTGAACTATGTCACAGAGGGCAGACTT
    CATGCCATCATATCGACACATGTCATAGGTGCAGATCTTTATGAAGTCTTCGGGATTCACCAGATCATGA
    CATGCTTTGAATTTGTCTGATTTTAGGACGTTGCACTGACTTTCAATGATTGGTTTATTCTCATCAGTGC
    AAGGAGGAACATCATCTTCTCTTGAGTCTGACAAACAACTGCAAGAAAGCACAGAAACAGCTGCACTTGA
    GTTTCAAAGGCAAATGTGAGACTGAGACAGAAACTGGAATGTTTGTTGCCACTGAAAGGTACTAAATAAA
    TAGTGCTGGAGACTGCAGTCTTACTTCTGTCTATGGCTGGAAGAGTAGCAGCAGTAGATGTGCATGACAA
    TCACTATGCTGTTTCTTGACCTTGGTTATGCTCACTGAACCTGACCCTGACAAGAGGACTGATTTCCCAT
    CTTGACCTTGGACCTGCCTCATCTCTGCGAAGTTGTGTGGTGACCTGGACTCTTTGCTGAGTCTGGCTGC
    CACCCTCGGGCACACACACTGCTTGCCTTCTGTGGACACTCTGCATGGGCTTTGGCTGGTGAACCCATGG
    TTGTACAAGCTGTGTTACCATGCTAGGCTCTCTGTACCTTAGGGAACAGCTGGCCATCACTGTTCCTGAA
    CTCCATTCTCCTGTTCTAAGTATGTTTTTCAGTGTAAAATAAATGTAAGCTGTGTCCACACTGTGGACTA
    CTCCAAAGCCTAATTCCCCACGTGTGTGTGTCCACAGTAAAATGGCTATGGTTTCCATCTGGCCTGTATG
    GTGATTTCTGGTGGTGATGGCTTTTTTTCTTTTGAGCTTTTAACTGAAGAAGACTAAAATCTCATACATA
    CTGTACATTACAAAGTCATAAAGTAGACAAGGCAATTAGAGGAAGACCGTTCCAAAGAAAGATGGAAGGT
    ATGAAGTAATGCTTACCCTGCATCACTGTCGTCTTCTACTTTCCAGCTATTTCCAAACTGTGTGACACTG
    ACAAGTGTACCATTGGGCAAGGACAGATCATCTTTATAATTGTCGTTGAAGTTACCACACATGCCTTGTA
    CCTGCAAGCAAACAAGAACTATACTCTAAAAACAATCTGCTCTGCACCAGCTTCCCCAGTAAGTTCTTAA
    TCATTGCCTCTGGAATGATAAGGTTGAAACACTAATGACAATCAATCTTATACTAAATATTTCAGACATA
    CTGATTGCACAGTAGAAAATAAATAGACACTATGATACCCTAAGACTTCAAACCATGTAATTCTATAAGC
    TGGATGTATTCCCCTAGCTGTGTCATTTTCTGTCAGTTCTCATTTGGAACACAAGGAAATTGGTGCGAAG
    AGAAGAAATAGGGAAAAAATGACTTGTGTTACAATACAGCTGTGAAGAAAGATGCAATAGCAAAATACAA
    GAACAAAGAAAATGAAAATAAATACACAAGCAGTGGTTTTGAAAGAATACCAATATGTCTACAAATTAAA
    TCTTACCTTTGAGAAGTAAGATTGTGGGAGAGTTATTTCCAGGTGGTCATCGCCATCATATTTGACTATC
    ACACCAAAGTCTGTTTCCACTACTAGGTAATTGCCAATATTTCCAATGGACACCCCCCGCACCCGGTTCT
    CCACTGGAGTGTAGACCCTCTCACTGTTCAGCTGGAAACAAAAATCATTTGTCAGTATGGATGATCTCCC
    ATGAAAGCTTTTCTGCTTGAATCTACATTCCTTGGAGTGCTGAAGATTACTCTGACAGTTTTAGATTCAT
    CACACTTTCACTATTACATATTCCACCTACAGGTTGCAAAAATCAGCTTTTCAGCTGAGGTGAGCTGGGC
    AGGGCTCTGGTGATTATAGCTATAGGTGACTGGCCTGACAACAGTTACTGAAGTGGGGAGGTACATTTTT
    TAGTTCAGAAAACAGTTCTCAGATCTGGAGGCTCTGGGCTCCACCTCCAAGAAATAGCAAATAGAACAAT
    GAAACGAGAAGACAAGCCTTGGGAAATAGTCAGGAATTATATTTCCCCACAACATCAACTTAAGGGAGGT
    GCCTGTAATTATTAAGGATATGCATACACGTTTCTTATGAAACATAGATGTCCTTTTTCCTACAGCTACT
    GTAGTGAGCTAATTTTAAGATAATTCTTGCTGGAATAAATAGCGCCAACACCTACCAGGATTTCTTTGCT
    TTTCCGAAGGGTGATTCGTGTACCATACACATCAATGTAGACTTCTTTCAGGTATGTGGCCCCTCTTAGC
    CCTCGGTCTTCGTTCTTGCCAAGGATGGTTATTGGGTTGACATTGTAGCTGACAGACTTAACCAAAGTGT
    AGGTGCAGGTACCCACAAATGTGTACATCAATCTATCAAAGGTGAAATAGTGGGGATCTCCTGCTACCTG
    ACACGTTACTTGGCCTGAAAGTGAAAAAAAGAAAGATCTAAGGACTTTGGCCTGGATTTTACCATGGACT
    CAACTGACCATAGACATTTGTATTAGTGCAGCAACTTAATCCTCATCACTATTACAAGGAGAAACTTTCA
    TAGAAGTATTTCAGGTTCATGTCAATGGCATTTACCTGGTAATGAGAAATTTCCAGTAGGTATCTCCTAA
    ATTTAATTAAAAATTACATACAAACTGGCAACTTGGCAACAAATTAACCTGTTTATCTGCTTCTATATGC
    TGCTGTATCCATAATGCATGCTAATTAAGAGTAATCCAGAGCTTTCCTATGTAGCAATTTGAGAATACCT
    AAATATATGAGTAAATATAGGTATCAATATGAATGTAAATAAATATGTATCTATATACATAATTATGTAA
    GAAACTTGCCAACAAACACTCTCTCAGAAATGGCTCTCAGTCCCAAATTTAGAACTTGCAGCACTGGTGA
    TTTGTTTCTTGAATTTGTATGATCAAGACAAAAAGAATCCAAGGGACCTTACAGGCTCTTAGGCAGCATC
    AATTTTTGCAGATATCAATTACAGAAGAAGGGAATCAGTGACCACAAGATAGATCATCATGTCTTCTTGT
    ATCTTACCACTGGCAGCAGTTAGTTGGAATTATCATTGCCATCACATATGAGAATGTATTTATGAGAAAG
    TTAGAGAGAGAATAAGAATCTAATCATAGAATTGACACTGAGAAGAATTTTCTGGGAGGACTTACCACTG
    GAATGACAGCCCAGCACACCATCCTTAACACTGCATTCCTCTCGTACTCCACACTCCCAGGATGAACAAG
    CAATCATGTTATTAGCATTGCAAGTGCAGCGTTCAGTGCAGGAATAATTGGTGAACCAGCTTTCACCCAG
    CTGAGGGGAAAAATATGTAGAATTATATACTATAAGATAAATAGGATAGTAATGCCATAAGGGACAATCA
    AATTACTAGTATTTGAATGTGCACAATATGTGATCATTTACTCACTTATGACAACAGAACTCAGTGATCA
    AGAAGGCTGGAAAAGTGAATCTTTTTTGCTATTACTAACAGTGTAAATAGCAATTGTGATAGTGTTTTTT
    CTCACAATGATAGCAATTAAGACATGTTGTTCGTTCTTTTTTTTCTTTTTCTTTAAATATTGTCTATGGT
    AACTTGCCTCATGATAGTGGTTTTTGTCATCAACACAACCACAGTTGCTTTCTGGCACACATGTGTCTCC
    ACTCAGAACATAGCCATCCTTACAGAAGCAACCCTCCACTGGCAATGAACTACAGGTACTAGCAGCCGAG
    GAGTTCACACAAGTAGAGGGACACCTAGTACCACAGCCTTTGTAGATGCTGCCTCCAGGACAGGATATTG
    CTGGAGGAAAAAGGAAAAAATAAGATCACTAAAAATGACAACATTTTTATAAAAATTATACCGATGCTTT
    CATTTCTACTGTTCGCTTCTGAAAATTAGGAAAACTGTTGTTGGAGAGTCTGACACTGGAGACTACAGAT
    TACCAAGAGTCTTCTTGAACAGTGAGATGGTGGGTGGCATCTGGCAGTGGTGGGCAAGACCAGTAGGCCA
    CCCTGCACCTATCTCACATAGGAAGTCAAACATTGCAGTCTTGCCTTGAGTGTAGGGCTGACATGATCAT
    ACAGACCTAAATGTGCTTCATTCTGTAATCCTTCTGGAGGTTTAAAGACATCCAGATGTGCTGGAAACTC
    TAATCCTTCTGGTTTTGGCTGCCTTTAGTATCTAAACAGGATTACAGCAGCAGTGCAGAGCTGTCTGGTA
    GTTTTTCTGAAAACAGCTTAGCTATGTTCAAAGCCCTGAAGATCACTAGTAGGTGACAGAGGGCAGTAGG
    GAGGCCATGGAAAAGAGGAGCATGGAAAAGATAAAACCCCTAAGTATGTACAATGCAGCTATGTCATGAC
    AGATAAAAGTTGCTGAGGCACTGCTTTCAAGTTTCATCAGAGTCAGAACCATGTATGTTCTGTCTTCCCA
    CCTTTGGGCAATTTAAGACAGAAAAGAGAGAATGGGGAGGAGCTGGTTAGAAAGCTGGGGCTGGCCAGGG
    AAGATATAAGGCTGCAGGAGGGATTACATCTTTACAAAGCCAGTTTGCATTACATGGATCTAAACTTCAT
    TTTCAGCAGTATAGTGGACAATAGTAAGTTTCATAAAGGTTTAGTTTGAACCACAACTCTCAAGGCTACT
    CATATCCAGGGATTAAATAAAGCATTTCACTCCTCTGAGCTCTGTTATTTCCTGACTACTCAAGTCACTC
    AATTAAGGGAGTAGAAGCATCTCTTCACATATCAGATGGTATGTCTCTGTTACTGCAGTTACTATCTGAA
    CACCGGTCACATTTAAAAATGGACCTAAAAATCAGATTCTTTTCCATTGAGACCCCCTGAGAAAATACAT
    TGTGCTCTCACACCCCTCAGGGAAAATACTGTATTTTACAAAAGTCTTGAATCATTTGTCTATTCCTGTG
    GTTTGAAAAAAACACCAAATAGTATTTTTGTGACGATCCGTGAAAAATCACCACATGTGAGTCTCATTCA
    CTTCCATAACTACAGCAGGATCTCTTACTCCTGTCAGACAATTACAGCCAACACCACCAGTCATCTATCC
    TTTTCAGATTCCTAATTGATTTTTTATTTGAACAACTGATGGAAGGAGCATTTGAGAGACAGTCCTACTA
    ATGTGACTGAGCAATCATCTTCTCTAACACCATAACTAAGCTGTAGGTATTTAGGTCCTGGAATATGGCC
    TTAGACTGTAGAGCCTGGAAGTCCGTACTTTTAATCTGAGTTGGGGGCCTCAAAGCTATTTTCTTCTTCT
    GTCTTCTCTTTACAGACAAAAGGCCAGTGCTCTGCCCTAGGGCTGACTTATGTGTGCTTTTAATCAAAGG
    CCATTCTAAAGTCATTCTTTTACCAAGCAGCTCCTGTCATAAAATTATTCCAAACATAATTAGTATGGAG
    ATAAATGAGAATACTTCTGTAAACTTCCTAGAAACACTTGTTTCTTAAAATGTCTTACTAAACTAATTTT
    TCTCCAAAGGCCATCAATGAATATTGAGAGCCTACAAATATCAGCTATGTTCGTATTGCGAATGGTGGAT
    TTTCAGCAAAGCAACGTAATAGTTACTCTCCCAGTGCAGAAGCTCACAAGAGATACAACTGACTATAATC
    CAAACTTTCCAATAAAATAATAGGAAATTATAAATATTTGAAGAATTAGACTAAAATGTATCCAAAAGTT
    CATGAAAATTATTGAATTATGACTCCCGACATACCAAAAGACTAAACTCGAAGCACTACATATATTGAAA
    CATCATACATGAAAAAGATAGAGGAGAATGTGAATAATTTAAAGTTTAAATACAGAATAAATATTTATAA
    ACCACAGCACTCACGGCAAAGAGTAGCATTTCTCCACTCTATACATATTCCAGCATTGATACATGACTCG
    GCGTAGGCCTGCAGTCCATAGCATAAGGATGTTGCCTGTCCCTCAGTGAAACACATGTCATAAACACAAT
    TATTGAAGAAATTTTCGGGAGGCACTTTGTTGTGGCAATCCTTGAAGATTCCTGTGTAAACAAAGAAAGA
    TACATAGAGGACAGAAAAGAAATGGGGAATTTATCACCATCAGCATCTATTGTCTGTCATGGCAAATGTA
    TTGAGTGCTCCAGGCTGACTTTGTTTAGTAAGTTAAATCAACACTTGAAAATGAGCACATACAATAAAAC
    CTGGCCCTCTGGATCAGGCTTGTTTCTTCTCCCAGTGTGATTTACACAACACAGCATACATAAATTAGGA
    CCTGCTGGCTAGGCAAACCAATAATTACAAGCAACTTCAGGGAATCTCTAATGCAGGAAACATCTACAGA
    ATTTCAGATGAAGTATCTATAATTTATGCAATGACAGTGCCCTCTGAACTATTTCATTTAGAAAGCAAAA
    TGCAAGTCACTACAAATCATAGAGCAGCTATGGTTTCTGGTGATCATTTTCACATAATCTACATGAACAT
    CTTGGCACTGTCTCATCAGTTGACATATCTTGACCTATGAATTTAATTTGGCCGTTGGCACTGGATATTT
    TATACACATTCAGTGTAAGGTCAGAACCATGGGTAAAAAGACAGCTACAAGCATTCTACCTGTTGGGTCT
    GTGATCATGCCACATGCTGTATTCTTCTTTGCTTCACTCTCCAGCACAGCATCACATTGGTCTTCTGTTC
    CGACAGAGCACCTTGGGAAAGCAAAAAAATGAAGTGTTTATATACATCTCTTATTACCAGATCTTTTGTG
    GAATTCTGACGCACAATAACCCCACATAACAGTGCATTTTGTTACAGTCAGAAAAATTTATCTAGCTTTT
    TTGAAAGGATGATGTGAGCCCATTTCTGAATGAATGCCCTTTTCAATGCCTTTTGGGCCAATCAAAAGAC
    TGTTCTTGCTGAAAAAAAAAAAAGAGCTATGGGATCCTGTAAGTTAATGATTTCCAGTCAGGGATCTGGA
    CAGCAATCACTCCTGACTCCCATAAACAGTTCTTGCTTTGGAAAACAAGGCTTAAAGGATGCAACCCCTC
    TTCTCATTCCCTCTTTAATAAGAAGAGGGAGCTCCGTACTTCTAGTGGGTAATTGGAAGATGCAGAGTAG
    TACCTGGATGACAAAGCCAGTGAATGGATAGATATTTGATTTCATAGAGCTTGATTAGCAAAAGTGATTA
    GATTCCTGTACATACATGGTGTTATTCTCAGGTACAAGCCAGCTTTGTCCAAGTTCATTGGAATTACTTG
    CAGTGTCACCGTTGGGCTTTATGTTGTCATCATTTGGATCACCATTATAATTACCTGTAAGGGTAAAAAA
    AAAAAAAAAAAGGATTTATAGGATACATGAAGTTCACACCTGTAGAACAAACATAGATTTCAGGCTATAA
    AGGAAAATGCAATGAACTAGTGAGAGTTTATATCCAATGCCAATGTGCACCGGGCAAAATAAGAAGAGTA
    CTTGTATTTGGATCTCATCTGTAGTGTTGGACTAAAAATCAAATATTATTGTCATTTGCATCATTACATC
    CTTGGGTAGGTTTCCTGAATTGAAAGTGAGAAACAACCACACAGAGGTAATTTAACTAGAATATTTCAGA
    TGATCAAGATCAAAGAATAATCAGAAAATCAGAAACTCATAATACAAGCTACTCTTACAATTTCTACAAT
    CCCATTTCCATCCTGAAGTATGTTTCATGTAATCAACTGGATTACAGAATGTTGTTCCAACTAAACCTGC
    TCAGATTCAGGCATTGCCAACGTGACTGATGAAAAATGACTGATTGCTACTAGCACTTCACTCTCATTAG
    CTACAAAAACCATCTGTGACTCTCAGTTACTTTGTGTTCTTACTGTAAAAGAACTTCTTACTGTAAAAGA
    ATGTGGTAGAATGTGCCCTTTGTGTCTGACCTGTTCTTTCTCAAAGGACTCTCAAAGGGTTCTATCTTTA
    GTGTTGTATGTTAATGTTTTGTGGCATTTGAATTTTTGAAACTACATTTTTTTTTAATCTTATTCATCAA
    GTCTATCACCTGAGGATCATCCATACTTGATTCCTTCATTGCTTTGTTTTACTCTAGACATTACCTATCT
    AAGGTAGAATAGAATCATTACTCACTCTAATTTACACTGATAAGTGAGTTTTGTGCTTTTTTTTTTTTTT
    AATCCAGCTAAAAATATTATTTGTAGCTATACTTCAAAGCATTCCAGACAGATAACATGTCACTTGATGC
    TTTGTAACAGTGTGCAGAGACTGAAAAAAATCAGTATTTTTTCTTTGCTGCTGTAAATTCTAGTTCCTTT
    GGTAAATGGTGGTTTTATGTAGATTAAGTATGAAACTAAGAAAAAGGTTTAAGTAACCACTAGTCTATAC
    AACTCACTAAAAAGTGATTAGTTCTGTGACTTACCACACAGGCCACAGAGCAGGCCACTGTAATCAGATG
    GCACAGAGACTTCTGCATAGTGATTTCCATCATATCTCACCCACAGTCCAAAGTCAGTTTCCAAGAGAAC
    ATAACTACCACTGTTTTGAATACTGATTTTCTTTTCAATAAAGATGGGTAGGTTCATTCTGCTGCCATTC
    ACCTACAAACCAAGTTGTAAAAGTTAGTGTATAGCTGCTGAAACTAATCCAACTACAAGCAACTGGAATA
    GTTTAGTGAAAGATGTCATTTTGTGCACAAAGAGAATGGGACACAATTAGATAATATTTCACCTTAGCAA
    ATTTTTTTGAAATCTCATTAAAAGAGGTACATGTATCCAATGACAAGAGAAAAATTACTATAAATTCTAC
    AACAAACAAACAAACAACAAAAAAAATTAATTATCTGCATGTTAGTTTAAAGATGTATTTCAAACAAGTA
    TTTTCTTACATTCACTTTCTTGCTTTTCAGCATAGAAATCTGGTAGCCATAGACTTCCACTTGCACTGAC
    TTCACATAAGAGACTTTGGTGTTGGATCCTCTGTGCTCATTTGTTGTGGACACATCAAAGTATGGAATAT
    TCTGAGAGATGTTACACACTTTGGAGAGGGTGTAAGAACAGTTTCCCATGAAATTATGAACTCTGTGATC
    AAAAGTGTTGTAATGTGGATCCCCAGAGGCACTGCAGGAAGCATGGCCTGGGAAGAAAGACAGAATAGTT
    TCCTCTGAATCTCTGCTGTAAATGCTGCAGTCACTTTGTTTCACTTCCTAATTGCTGTTCAGTTGTGATA
    GTGATGGCTTCAGTCAAGAACAGAGTGCAAAGGAGGTATGCAAACTTTTCACAGGAGAGAACACCCTTCT
    ACCATAACTGGAAGTCACCCACATTCTGTGACAATTCATGAAGAGCAAGCCATCTGATCCAGAGACTCAT
    TTTCTGTATAGTAGAGACACACCATATGAAACATGATACCTAGAAGTTGATCTGAATCATGAACATCCAA
    ATAAATAGGATTTTCATGCCAATAACTACCTTGAGATTGAAAACAAGACATTCCAAAACCTGGGCTAAAT
    TCCAGTCTTTGTACCCCAAAAGAGTATGTACTCTGGTGTACCAGAAATCTCTGCTAGAGGCCAATGAAGA
    AATATGAGAAAAAGGATATTAAGACATCAGTATATAAACTGGAACAGTGAATTTGCAGTGGCCAATTCTG
    AAAGGCTATCTCTGAATATATAGAAATAATCTACGCAAAAACATTACAAGACTGGCTCCTCTGTTTTGGC
    AGCTGGAATGAACTGCTGCAATACCAGCTGTCTAGAGTTCTGTAGTTATATCAATTATAGAAATTAAGGA
    AAACCTCTGACACTCCAGCATAACTCTGTTAATTCGGCTGTTAGACCTGAAGTTAGAAAACTGAACAAGT
    AAAATAGGCAAAAAAGAAAAAGGAAATAGGAAACAAAAACACATGAGCTTAGCTGGGGTGTGGATGGCAT
    TTGGGGAAGCTTAGAAGAGCTGTCAGGATATGGGCTTGTAGGCTTTGGGGTTGATGGAACTGCAATAAAT
    CAGAGTTAAAGGAGGTCTGATTCATCATGAGACATTTGCTCCAAGTGCCTGACACAAATTGCATCAAAAT
    TCTCTATAATGGCAAAAATTACCACAGATAAATAGAGATAGTGAAGTGAAAAACTCACTGGAACTTGGTG
    TAGGTGATGGAGTTGGTAAGTGTGAAGGTGGTGTTGAGATGTCTGGTAAGGGTGTCCCAGGTTTTGGAGT
    TGATGGACCTATTGTAGGAGAGGTATAGCAGAAATTAGAATCAATATGCAGTTTTACCCCCTGAAGATGG
    TACACCCTTTCCAAACACCTGAGTGCCATGACAGTATTAACCCAGGACAAAATATACACAGTAACTATTC
    TAAAAAAACTGTGCCAATCAAGTACTCCCCGAGCAGTATGGCTGGGGGAAAAGCAAAGTATAGACCCTTA
    AAATGGCAATTCCAAACCCTAGCCAGGGACCTTGAAGGAATCGAACAAAAGAGATGCCAGAAAATGTACA
    AAATGGGCTCAGGTCATGACAATACCTGAGCTTGGTGTGGTTGTTATTGGGTGTGGGGGCGGCGTTGAGA
    TGTCTGGCAAGGGTGTCCCAGGTTTTGGTGTTGATGGTCCTATTGCAAGAGAGAGGTAGTGGAGCTTAGC
    ATCAACATACTGTTTCATTCCCAGTTGCCAGTATGCCCTTCCCAAACACCCCAGTGCCATGACAGCAGAG
    GTACTGAACAGGGCATACACAGGGAGTCTTCAAAGAAAACTCTGCTAATCAAGTACAATCCCAGCAGCGA
    GGCTAGGGGAAAAGGAAACCACAACCCTGTTTCTACAGCCATGCCAACCCCTAGCCATGGACCCTGATGG
    AAATCAACAAAAGAGTTGTCAGAAGCACTGCAAAACCGGTTCGCGTCATGACAATACCTGAGCTCGGTGT
    GGTTGTTATTGGGTGTGGAGGCGGCGTTGAGATGTCTGGCAAAGGTGTCCCAGGCTTTGGTGTTGACGGT
    CCTATCGTAAGCCAGAGTGAGAAGAGATAATATTCAATATGCTGTTTAATTCCAAGCAGCTGCAAATGAC
    TTCAAAAATACCACAGTGCCATGACTGCATAGGCAAAGAACAGGGCATACACAGGGACTCTTGTAAGAAA
    AACCTGTGCCACTCAAGTACACTCCCAGCAGAGAGGCTGGGGGAAAAGGAAACCACAACCCTGTTTCTAC
    AGCCATGCCAACCCCTAGCCATGGATCCTGATGGAAACCAACCAAAGAGTTGTCAGAAGCACTGCAAAAC
    AGGCTCGCGTCATGTCAGTACCTGAGCTCGGTGTGGTTGTTAGTGGGTGTGGAGGTGGTGTTGAGATGTC
    TGGCAAGGGTGTCCCAGGCTTTGGTGTTGACGGTCCTATTGCAAGCCAGAGTGAGAAGAGATAATATTCA
    ATATGCTGTTTAATTCCAAGCAGCTGCTAATGACTTCAAAAATACCACAGTGCCATGATCGCAGAGGTAC
    TGAACAGGGCATACACAGGGAGTCTTCAAAGAAAACTCTGCTAATCAAGCACAATCCCAGCAGAGTGGCT
    GGAGAAAAAGGAAACCACAACCCTGTTTTTACAGCCATGCCAACCCCTAGCCATGGATCATGATGGAAAT
    CAACCAAAGAGTTGTCAGAAGCACTGCAAAACAGGCTCGTGTCTTGACAATACCTGAGCTCGGTGTGGTT
    GTTGTTGGGTGTGGAGGTGGCGTTGAGATGTCTGGCAAGGGTGTCCCAGGCTTTGGTGTTGATGGTCCTA
    TTGCAAGAGAGACGTAGTGGAGCTTAGAATCAACATACTGTTTCATTCCCAGCTGCCAGTACGCCCTTCC
    CAAACATCCCAGTGCCATGACTGCATAGGCAAAGAACAGGGCATACACAGGGACTCTTGTAAGAAAAACC
    TGTGCCACTCAAGTACACTCCCAGCAGCGAGGCTGGGGAAAAAGGAAACCACAACCCTGTTTCTACAGCC
    ATACCAACCCCTAGCCATGGACCCTGATGGAAACCAACCAAAGAGTTGTCAGAAGCAGTGCAAAACAGGC
    TCGCGTCATGACAATACCTGAGCTCGGTGTGGTTGTTAGTGGGTGTGGAGGTGGTGTCGAGACGTCTGGC
    AAGGGTGTCCCAGGTTTTGGTGTTGATGGTCCTATTGCAAGAGAGAGGTAGTGGAGCTTAGCATCAACAT
    ACTGTTTCATTCCCAGCTGCCAGTACACCCTTCCCAAATACCCCAGTGCCATGACTGCAGAGGTACTGAA
    CAGGGCATAATCAGGGAGTCTTCAAAGAAAATTCTACTAATCTAGTACAATCGAAGCAGAGAGCCTGGGG
    AAAAAGGAAACCACAACGCTGTTTCTACAGCCATGCCAACCCCTAGCCATGGACCCTGATGGAAATCAAC
    AAAAGAGTTGTCAGAAGCACTGCAAAACAGGCTCGCGTCATGACAATACCTGAGCTCGGTGTGGTTGTTA
    GTGGGTGTGGAGGCGGCGTTGAGATGTCTGGCAAGGGTGTCCCAGGCTTTGGTGTTGACGGTCCTATTGC
    AAGCCAGAGTGAGAAGAGATAATATTCAATATGCTGTTTAATTCCAAGCAGCTGCAAATGACTTCAAAAA
    TACCACAGTGCCATGACTGCAGAGGTACTGAACAGGGCATACACAGGGAGTCTTCAAAGAAAACTCTGCT
    AATCAAGTACAATCCCAGCAGCGATGCTAGGGGAAAAGGAAACCACAACCCTGTTTCTACAGCAATGCCA
    ACCCCTAGCCATGGACCCTGATGGAAACCAACCAAAGAGTTGTCAGAAGCACTGCAAAACAGGCTCGTGT
    CTTGACAATACCTGAGCTCGGTGTGGTTGTTATTGGGTGTGGAGGTGGCGTTGAGATGTCTGGCAAGGGT
    GTCCCAGGTTTTGGTGTTGATGGTCCTATTGCAAGAGAGAGGTAGTGGAGCTTAGCATCAACATACTGTT
    TCATTCCCAGCTGCCAGTACACCCTTCCCAAATACCCCAGTGCCATGACTGCAGAGGTACTGAACAGGGC
    ATACACAGGGAGTCTTCAAAGAAAATTCTACTAATCTAGTACAATCGAAGCAGAGAGCCTGGGGAAAAAG
    GAAACCACAACGCTGTTTCTACAGCCATGCCAACCCCTAGCCATGGACCCTGATGGAAATCAACAAAAGA
    GTTGTCAGAAGCACTGCAAAACAGGCTCGCGTCATGACAATACCTGAGCTCGGTGTGGTTGTTAGTGGGT
    GTGGAGGCGGCGTTGAGATGTCTGGCAAGGGTGTCCCAGGCTTTGGTGTTGACGGTCCTATTGCAAGCCA
    GAGTGAGAAGAGATAATATTCAATATGCTGTTTAATTCCAAGCAGCTGCTAATGACTTCTAATATACCAC
    AGTGCCATGACTGCAGAGGTACTGAACAGGGCATACACAGGGAGTCTTCAAAGAAAACTCTGCTAATCAA
    GTACAATCCCAGCAGCGATGCTAGGGGAAAAGGAAACCACAACCCTGTTTCTACAGCCATGCCAACCCCT
    AGCCATGGACCCTGATGGAAACCAACCAAAGAGTTGTCAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGTCCGGT
    ACTCACCGTTCACCTGGGGCAGACACAACGCAATGCACCGTGGACTCCCTGGGGCCGTCAGCCCCATGGG
    GACTGGCTCCCTTCTCACACAGAAACTCCTGCTGCTTGCAGGTAAGACCCTGCCCAAAAAGACCAGCCTT
    GCCTTGCAGACCCACCGCGCACACGCCAGACCCACTCCCTTACCAGCACTCGGCTCCTCTCCTGCTTGAG
    TATGGTAATGCGCTCTCCATACACATCGACCACGACTTCACGCACGTAGGACACTCGGGGGTTGCCACGA
    TGCTCGTTCTTTGCCTCAACGTTGAAGTACGGCACAGAGGTGTTGGAGCACACTTTGGCCAGGGTGTACG
    TGCAGTTCCCCATGAAGTTGTGCGTCACCTTGTCAAAGGTGTTGTAGTGAGGGTCCCCGTGGACGTGACA
    GATGCCGTAGGAGTGTTCCAGGCACTCGGGTTTCCCATTCTGCACACCACAGAACTGGCCAGCAGGGCAC
    GATGCACTGGAGCACTGGACTTTGCCTCCTCGCGTGGGACATGTGCACTTGGACGAGCAGGTGTTGTCCG
    TCCAGAACTCTGAGCCCACCGGGTAGTGCTGCCCGTTGTGCCAGCACCCACACTGCTGGATGGGCACACA
    CTGACTGTTGTAGAGCAGGTACCCGCTGTCGCATACACATCCCTCCACGCACGGCAAGCTGCAGTTATAT
    GGTGCCGTTGGGCTAACACACGTAGCAGGGCAAGCTGCAGCACAGGGCTCGTAGTGGCTGTTGGCTGGGC
    ACGTGATGGCTGCCAAGACAAAAGGAAAAGCAGTGAAATCATCAGTCATCCTACACCCGCAGTGCTCCCA
    AGGTAGGCCAGATTCACTGGGGGCTTTGGAAGGATGCAATCGCCCCACAGCTCCTCCCAGCTGCCCCAGT
    GGGATGCCTTCTACATAGAAAGAACCACACCGGCAATGTGACCAACAAAGGGTGCTCCCACACTCACAGC
    AGCTAACCAGCTCAGAAAATGGGGTGCTTTTCTGTTTCTGACTTACGGCAGAATGTTGCGTTCCTCCACA
    CAGGGATCTGGACACCAAGCGCCTGGCAGGCATCTGCATAGGACTGCAAGCTGTTGCACAGCGCCTCGCG
    ATCAAGCCCCAGCTCACACAGGTCATACAGGCACGTGTCGAAGTAACCGCTGGCACTCAGCACGGCATGG
    CACACCTCAAACGGGCCGCTGGTGTCCGTGAGGAGCCCACAGAAGTTGCTGCTGGCAATGACTTGCTTGT
    CCGTTTCAGTGCAGGCTGGCGGGGACTGCGTCCCAGCTGAGCAGCTATAGTGAGGCAGAGAGAACAGCCC
    CCGGGTTATCTGTGGGCTTCTCCTGGCAGCTCCACTCCACCCCTCCCCAGACCTGCTGGGGCACTACACT
    CACCTGCTGTCATTAGACACCTGCCAGCTGTTACCCAGGCTGGTGGAGTCTGGCTCCAGCACCCCGTCAG
    GGTTCAGGAAGTCGTCTGCTGCCATCCCGTTGTAGTTGCCACACATGCCACAAACCTTCTGCCCAAAGGT
    GCTTGGAAGCGTCACCTCCACCCGATGGTTCCCATCAAACTTCACTCTCAAGCCAAAGTCTGTTGTCACC
    ATGGTGTAGAACCCGCTGGACGAGACTTGCACGCCCACAGATGGGGTGCAGGGCAGCACCTCTGGCTCGC
    CGTTGACCTGGAAGGACAGAAACCCAGACAGGGTTGGAGCAATCCCTTTGGCACGGCTCTCCCCCGGCAC
    AGCCCCGCCACTGCTCCCCTTTGTGCTTACCGTCACCACGCCACCCTTCCCAAGCCTTATGCGCTGGCCG
    TACACATCAACGTCCACGTACTGGACGTAGGACACGCGAGTGTTCCCTCCTCGGTGTTCATTGGCAGCTT
    CCACGTTGAAGAAGGGCAGTGAGCTGTTGCTCTCGCACAGCTTGGAGAGGGTGTAGGTGCAGTTGCCCAT
    AAAGTTGTGGATTTGCTTGTCAAATGTGTGGTAGTGAGGGTCTCCCTCCACCACACACGTTCCTGACAAA
    ACAAGCACCAGAGAAACCCTTCAGTTAGGCACCTCCTTCCAGCGCTTCTCCCCTTTCTACAGTGCTAAAA
    GCACTGCGTCCCAACGACCGCTCTCCTCCATTCACCTGAGCCTGGCTGTGGTGTTGGTGTGGTTATTTCT
    GCCACAGGTGTGGTGGTGCCGGCGCCTGGTGTTGGGGTCACATCGCCTACAAAAGACACAGTGGCACATG
    CCAATCAACCCTCCTTGCCCACGCCCTGTTCAAGGCAGAAAATGCACTGACTGCCACTACAAGCAGGCTG
    CCTTTCCCCAGCCAGTGTCACGTACCTGGACAGTATCCCTGTTCAATGGACAGATCATCCAGTGCTACGT
    CACTGCGGAAATCTTCACCTATCATGCCCTCAAGGAGAATCTAAGAGAAGGGTTTTTTTCCAGCATTATT
    TCCAGCCATATACACTGAGTGCTTTTTGAAAGCGCATGGCAGTTAGAGACCCTGTTCCTACCTGCAGGTT
    TCCTGCACTGTGCACTGTGACCTCTCCCAAGATCCATCTGTCTCCTTTGCTTCCTGCTTCTTTCCATACC
    AGTGTCGATATCTCGTTGTGTAGAACGTACACCCGCAGGGCCATGGTTTCAGCCACTCCGTACATGTGAT
    ACCAGAAGCGGAAGCAGTGTGGTCCCGTTGAATTGCAAACTGTGCTGACCAAGATGGCTGTCTCACCTGG
    CTTGTGCTCGTTTCCTTGCAAGTAGATATAATACCCATCTGGAAATAACACAGTGACAGTTTCTCATATT
    GTTGAACCAGGAGAAGGCTAATTTACTTCATTTACATTTTTTGTGCTAGTACAGTTTTCTGGGAGATATA
    ATGACAGTAGTCAGCAAAAAGTATTCATGCTACTGAGACTAGATCACTTATCAACAGAACAGGTCGTGTC
    TAGACAGCTCTGGCCAGTACGAGTGGGGTGTGGGAGTATGAACAATTAGCCAGTCTGTAATACTTCAGTA
    TACCTCCACCCAGCACTGCCACTAAATTTCTGCTTCCCAAATAGATTTCCAGCAGATTAAATTGTAGTTC
    TGCTTTGGGAAAAACTAGCATCTTGAAGTACAGGCAGGCTCTGAAGTGATCCAGTGTCAGCCTGCATATG
    GTTTACTGAAGCCTTTCTGCAGCTGAGTCTACAAACATATGTTACAAACATTACATGCCCATAAATGTGC
    TGCACTGTTCATCCACCCCAAGACAAATTCCTGGCTGCTGCAGAAAGCTCTGGACAATGCTCAAGAAATA
    AGTTGCCTGGATTTCCTGTTAGAAGAGCCTCTTTGTGCTCTTCCCAAAGATTGCTGTATCTGAAATAGAA
    CCAGATAGCATTTTCTGTTCCTACCTCCTGTTGTGTGGTCATGGGGAGGGCCGGTATTTGGTGAGAGTGT
    TGGTCCCTTGTTCCTTATCCAGTCAAAGTTGTCATTGATCGCCTGTTCCCACTCACAGAAGTCAACATCA
    AATGTGCAGGACATATTGCAGGCTGTTGGTGCAGCTATATATGTTGCAGAAAGAAAAGCAGTTTCCACAA
    TGAGGTCTGGAATCTTCTCTCTGTTCTGATAATATCCTTTCAGATCTAATGCATTCATGTCCATTAAACA
    TTGGAAGATGTTATGGAATGAGTAGAATTAATCCATACAGAAGGATGGATAATAAAATATGAAATTCTAA
    GTGTCTGAAAGTGTCTGTTATTTGGCAAGTCCGTTATTCAGTTGTTACCATAATGCTCTAATATCCTCAG
    TTTTTACACTGTGCCACAGTCTTAATCTTTGGTCACTCAAAGCTCTCCTACTTGGAACAGTGGTATTCAG
    CTGTTCAAAGTGTAGCTTGGGTAGAAATCTAAACACTGTAAATGGGAATGGTCTGACAGTTTTTTTATGG
    TTTCTAACCTGCGATGAGAAATGCTGTCTGAGCTAGAAAGAGGTTATGGGATGCCTTTTGATATCATAGA
    CTCATCCTGTTCCTTCTGCTGGTTTTGGCAGTCACATCTTGTAGTACAGAAGAAGCAGTTTCATGTCTCC
    AACTTTACTACTGTGTTGACTTCTATGTCCACGCAGATAATAAGGGTCAAACAGTGTTATGTCTGGGAGG
    CTAAATGGCCTTAACTTGCAGGATACCTTATTAATTTTAATACTCTATACAATTCTTAAGTTATTTCACA
    TTTGGTGCAAATCTGGAGCTGTAGACCAGTTCTGTAAATGTTGTATTAACCCTTCTCAAAAATGTGAAAT
    ATTTTAATGGAGCCAAAGTGGTGATTTGCTTGGAAATAACACAATAACTTGGTTTGGAAGAAACCAATAA
    GTGCTTAGTTTTCCTTGGGTGATCATTTAACTGGCAGCATATGCCAGCTTTCATGATCCAATAATGAACA
    TGTTAAAAAAGTTTAAACATTATGGCTTAAAGTGAACACTGAATGACCATTACAGGTGTAGATTAGAAGA
    CTGATTTCCTCAGATGCTAAAAAACCAAAATATTTCTGTCTTCCTGAATTGCCCTTTCAGAATTTCTGTT
    CAGCTCTTTAGTCATTTGAGTTTACATTTGTAACATGAGGATATAATTGGATGTCTATTTGCTGAATGAC
    CTATAACTTACCGCAGATGGTATCTTTTCTCCATTCTCCCAGATTTACACCTTCAAGCTCACAGGCAGCA
    GCATATGCCTCTAAAATTTTGCAGAATTGTTCAGAATTCCCCTCTGTGGCACACAGGTCATAGACACAGC
    TCTCAAAGTACAGCTGTGGTGGAATGTACCAATGGCAAGCCTCAAAAGGTCCACTATTTTTCAAAATAAT
    TTTACAGATTTCTTCGTATTCTTTCTCTTTTCCTGTGTCACAGGTGGGTGGTACAACTGCAACTGGATTA
    CATCTGTATTAAAAATAAACAGCAGTATACTTATATTTTGCTCAACCCTGCAAGGTAAACCTCAAGAGTA
    ATAGAACTCTATGCCAAATTCTGTGGACTTATTGTGTATTCTTGCCTTTAGTTTGTCAAACCCCAAAGTG
    AGAAATATTGTAATTCGACCCACAGTTCCCCATTAAGAAAACAATAGCGAACTGTTGAGATGTAACCACC
    TGTCCATAGACAGAAGTCCAAATGGAATCAACCATCCAGATATTTAGCTCAGATAATTTCAGTTCACTAT
    TGCCCATAGTAAGATCACTACTTTGCATATGAAACCATTAATAGGCAAAGAAATGCTCTGTGTCCCACTT
    AGTCAATGTAGAATTACATTAGAAATAGAAGCTGAAGAAAATATTTAGCTTTCTTACAGTTAGATGGTAT
    AAACAAGGTATTTTAAAATAGAAAGATAAGAAGAAATGAAGTTAACATCCAAGAAAAGAGCTTGATTTCA
    AATAAACTTTATGTAGTTCATAACAAAAATCTTTGAAGGGTAATTTTAAAATTTCAGTGCTTTCTACTGA
    AATGTAGAATTAGTAAAAAGGTTAAGATTCTAGCCAACATAATATCAAAAAAGGGATTCTATGGAATGCA
    TATCATGTATTTTAGTTAATCTCTTAAGCAGATCTATGACATATTTTGTTGTTTCCTATAATATTATCAT
    ATACTTACACCCAGTTGTCATCCTTCAGTAGCCAGCTGTCACCAAATTTATTTGGATCCTGTTCTAGGAC
    TTTATCCGGTTTTAGAAAATCATCCAGCTGGTTGTCATTGAATGTCCCACACAAACCACATAACTGTCCC
    CTGAGACTTTCATCAACCTGAATAAAAAGGTCCTGGTCGCCATCGAACTTCACCTGTATCCCTACAGAGG
    TATCAATGACTACATAACGTCCTTTTACAGCTACTCTGGCTCCATTCTTCAAATCCACAGGAGGGAAAAC
    CTGAGCTCCATCCACCTAAAGAAAAGAAAACCAACACAAATGGGTAAGTCAACAACGTTCCTAGGAAAAA
    AAGGAGAGATCTACACTGATAATACTGCAAGTTTTCTTCATTGAGTCAGCCTTATCCTAAGGAGCAATGT
    AGTCACAGAAGTTTGAAGGGACATTCATACTTGTCCCATATCTTGAATTCAGGTTTGTAGAACAACTTGA
    GCTCAGCACTGTTGCAACTACACGTATAGCAATACTTGGAATAGCTAGTTTAAAGCCAGCTCTGGTATGT
    AAGAGAGCATATAGCAAAAATGTTATTTCTGTTCTAAAGACCCAAACTGTAAAATGCAGATGGGCATTTA
    GTTCAGCAAAAGCTTTCTATTAAGGATAAAGCTCCAGATGGAGCTGCTTTTTCTAAAATGTTGTGCATAA
    AATATTTGAAAGGATATAATGAAGCTATGCTGATATCTACATTTCTGAAAAAATATTTCAGTGACTTCTT
    TCATATATATTCTTGGAGGTGAATAAAGCAGAGAAACCTGATTCTGTTATTTTGGATGGAAAAATGCAGT
    GCACTGATATGACTGATTATTTGTGCTTAAAGTGGAACACTTACAAAGGTCTCTTTGTCTCTCCTCACAA
    CAATATGAAGATTTTTCAGTGTGACAGCAACTGAATCCAGGGCTGTCCAGTTTGGGTTTCCTCTATGCCT
    ATTTCTGGTTGTCACTGAAAACCATTCAGAAGAGTTTGTGCAAGTCTCGACAACTGTATAATTGCAGTCT
    CCTTGGAAATGATACAGTCTCCCATCAAAGGTTACGTAATGTGGATCCCCGAAAATGTGGCAGGTGCTGG
    GATTTAATGGATAACACCCCAGGAGTCCATTCTGCACCTTGCAAACTTCATTTGCTTCGCATGTGTCTGA
    ATTGCAAAGCACAGTCCCATTTCCAACACATATACATTGGCCTGCACAGTTTGTTTGCCAAAAAGTTTCT
    CCTTTCTGTAAGAGAAGACAAAATAAAAAGAAGTTAAAACAGTTCATGTTAATGATCAAATGATCAAATG
    TAAAATAAAACCTCTGAAATATGTGATAGAACAAACCTCATAATATTTGTCATTCTGTAAGCAGCCACAG
    TTGCTCATAGATACACATTGTGCCCCACTGATGACAAAACCATCGTTGCATTCACATCCCTCTACACAAG
    GTTTGCTGCAGTTGTTTGATGCAAGAGGGTCAGTGCAGGTTGCAGGACATGCACTGGTGCATGGATTGTA
    ATGGCTGTTAGCAGGACATGCAATAGCTGAAAAAGAATAAAAGGCTCTCAAATGATAATTACAACTCACA
    TCAACCCAAAATATGAAACTGAGATTATTTTAAAATACTGGCTATATTTTATCAGAAATATTATCAGAAT
    ATAAAATTTATTTCCTGGTTTGAAATCAGAAAGAAAAATAATATTCTACAAGAGAAGGGCATGAATATTA
    ACATATATTGTTGAAATTTAGCAAATTCAAATCAAAGAGAAAAATAAGTCACTCTATAACAGGTCCAGTA
    CTTAGTTGGTACATGAATTATTGAAGCTATTAAATGTAGACAGGATACTAACAAACATATTAAAAGCAAA
    ATATGTGATAAAACACAGAGGTGATTACATACTATCATGGGCTTACTGCTAACTCTATGACATAGATTCT
    TTCAATAATGAGCACAGTTCTCGAAAGAGATCTGGCAGTAAAAAGAGTGGAGTGACCGTTGTAGAAGATT
    ATTTCTCAGCATTTCATGGGGGAATGTAAGCAGAATTTAAGATTTCTAAGCTATGTCTGTTAACGCCTGA
    AAGCAGACTTTTGAAAATGGAAGGAACTATTCTAAGATTCAGTTCTACATAGGTACTCACGGCAGAAGGT
    GGCATTCCTCCAGGGGAGCAGAGTCACACCAGCTGCCTGGCATGCGTCAGCATAGGCCTCCAGCGCACCA
    CACAGCACCTCCTGCGCACCACTCATGGCACAAAGGTCGTAGGAGCAGGTCTCAAAGTAGCTCTGCGGGT
    TGATCACGGCGTGGCAGCTCTCAAAAACGCCTGGTCTGGCTGTCAGCATGCCACAGAACTGCTCGGACTC
    GTAGAGCTTCTCCTTGTCTGCAGGGCAGGGCTCTGTTGGTGGGGGCACGCCGCAGCTGGGGTCACTGTCA
    CTGCTTGGGACCTGCCAGCTCTCCCCCAGCGCATTGGAGTCTGCGGCTTGCTGCCCGTTGGGCATCATGT
    AATCGTCCTCTCTCCGGTTGTTGAAGTTCCCGCACATGCCACACGTCAGGTTGAAGTAGCTGCTGGGCAC
    CTTCACCTCCACCGAGTGGTCAGCGTCGTAGGACACGTGGAGGCTGAAGTCCGTCTCCAGGACGACGTAG
    CGGCCGCTACTGCTCACGGTGATGGCTCCTCCTGCTGCGCTCACCGGCAGGGTCCGGTACTCACCGTTCA
    CCTAGGGCAGACACAACGCAATGCACCGTGGACTCCCTGGGGCCGTCAGCCCCATGGGGACTGGCTCCCT
    TCTCACACAGAAACTCCTGCTGCTTGCAGGTAAGACCCTGCCCAAAAAGACCAGCCTTGCCTTGCAGACC
    CACCGCGCACACGCCAGACCCACTCCCTTACCAGCACTCGGCTCCTCTCCTGCTTGAGTATGGTAATGCG
    CTCTCCGTACACATCGACCACGACTTCACGCACGTAGGACACTCGGGGGTTGCCACGATGCTCGTTCTTT
    GCCTCAACGTTGAAGTACGGCACGGAGGTGTTGGAGCACACTTTGGCCAGGGTGTACGTGCAGTTCCCCA
    TGAAGTTGTGCGTCACCTTGTCAAAGGTGTTGTAGTGAGGGTCCCCGTGGACGTGACAGATGCCGTAGGA
    GTGTTCCAGGCACTCGGGTTTCCCATTCTGCACACCACAGAACTGGCCAGCAGGGCACGATGCACTGGAG
    CACTGGACTTTGCCTCCTCGCGTGGGACATGTGCACTTGGACGAGCAGGTGTTGTCCGTCCAGAACTCTG
    AGCCCACCGGGTAGTGCTGCCCGTTGTGCCAGCACCCACACTGCTGGCTGGGCACACACTGACTGTTGTA
    GAGCAGGTACCCGCTGTCGCATACACATCCCTCCACGCACGGCAAGCTGCAGTTGTATGATGCGGTTGGG
    TTAACGCATGTAGCAGGGCAAGCTGCAGCACAGGGCTCATAGTGGCTGTTGGCTGGGCAGGCTAGTGCTG
    TGTAATGTAAAAGATTAATACAGAAGTTTATATTTTAAATATTGAAGTATTTGGGTTTATTTAATGGCAT
    ATTCTGTTTTGTTCTGCAGTCTTGAGGACACCCTGGAATCCTGTGGCAATGCAATCCTTGCCTTTTCTGC
    GTAAGTGCCCTTTAACATAGTTCATGGTTGTGGCTCCTAACAATTTCTCTGTCTGAGAATTTCTTATGAG
    ATCTTCTATTCTGGTCATTGTTTGCTACTTTTTCCAGCTGAGGATATCTGTGTCATGTTATTTGTCCTTG
    TCATGTGCCCCATTCAGGCTACAGGTCTGATAATTCTAATCATATCATAGCTTCTGAATTCATACTTTTT
    CAATCCCTGAAGTTCTTTAATGTTTGTTAAATAATCGTGATGTACATGCACCCTATTCTGTTTTTATACC
    TTGCTACACATGTCACTAGTTAAAAAGAAAAACTAAGCTAATTCGAAGTTCTTCTAACCTCAATCTTCAG
    TCTCTTTTCAGATTCTGTACACTTATGTGATGTAGTTCAGTTTTTAATGACATGCCCCACTCTATTTTAG
    TCTGCTTCCTTAAGCAATAGAGATCATATAATTACATTGTATATTTCCCTGTCCATCCTCTCATTAATTA
    GAACTGACCCAGAAATAAGTGAGGTTGGCAGAGGACAAAGGCATAGTTTGAAACAGGAGTAAGGCAAGCA
    GGAGAGACCCGCAAGCTCCTGCAGCAGAAAGAACAGCTACAGAGAGGGTTTATTCCTGCTTAGAAATCAC
    GGAATTTATGTGGGAGTAAGCCTTAATAATATCCTTAGCAAATAAAATGCTCCAGCAAGAGATTACAATT
    AATTGTGAAACAAATATCCAGAGTAAATTTGGCTTCAGCCATTTCAGTGTTTGCAGACCAGCATCTTTCT
    TGAGTCTCCTCATCTCCCTCAAGGCAGAGGGCACACAGGCCACAGCAGAATATACTGATTCCCAGATCTT
    CTGCTCAGTTCATCAAGCATTTTTCTGCCTCATCCTGCTCTCTTTACATTGGTATAAATTCTGAATTTCA
    GACATCTTTACTGTTCAGTCTCAGATCTATTCCTCCCACCAGTTTTGATTTTATCATTCCTGCAGGGGCA
    ACAAACTGACCCCCTGACTGGCTACCTAGTCCATGTTCCTTCTACTTAGTTTAGCCAGTCTCAACATGTA
    CTTCCACTTTTCCATAGCCCTGTAAGCATGTTCTCGTTTTCCTTTCTAGAAGCTACTTGCCTTCTCAAAA
    TCCAGGGCCTCCCATTTACCCCATTCAGCATTTCTCTCCAGTTCTTAATCAAAGCTCCTTTCTCATTGCC
    CCAGACCACCTGGATTCCTTATCTACAGCAGCTCTGCCCTTCATCTGCTCTGGCTCATATCCCTTCTGTG
    TTCACATGAGATATCTGTCTTAATGAGCTTCTGCTGGGGTTGCTGCAAGAGAAGGCACAACCTCCTTTCT
    GTTGACTGGGTGCCTGGTCACCCTACAAGGTGAAGAGGCTAAGAGAATAGAGTAAGGTATCTCAGCTTCT
    CTACAGGGGGCGTGGGTGAGGCTCTCACCTCTACTAAGCATGTGCAAAATGAGATTTTTTTTTTCCCCTC
    AAAGACCCTAAAGTTTATGCACAGCTTCCTCAGAAGGTAAAAAACCCTCAAAGTCAAATGTCCCTGATAT
    ACTTAGTACCCCTGAACAAAAATATAGGGTAGGAGAAGAATTCAAAAGAAAAGCTCTCTACTTTCATCAG
    TCTTTCTAAAGGACTCAAGGATTCAAGCTAAGGACTACACATGATTCTGAAATCTTTAGCCTCATAGGTC
    AAGATTTACAGTGTTACAGGAATTTAAAAGAGTTTCTTGTAATGCTCTCTCTTCAGGCAACCCTAATGAT
    ATCCTCCTGACAAATGGTAATTTCCAGTAATCTTTGATACGTACGGCAGAAGGTTGCATTTCTCCATGGT
    GTCAGCTGGACTCCTGCAGCTTGGCACATGTCTGCATAAGCCTGCAGGTTTTGACAGAGGGCTTCGCTGC
    TCAAATGAAGCTCACAGAGATCATACTGGCAGTCTTCAAAATAGCTCTGTGGATCAACTACTGAGTGACA
    ATTCTGGAATGGACCACTGGGATCAGTGATCAGACCACAGTATTTATTGCTTTGGATCATATGTTTTTCA
    TCAGCAGTGCAATTTGGGATATGGCCATCATCTGGCAAGCACCTAGTGTGGAAAAAATAGATGTGGAAAA
    TGTCACTAGTGAACTTTGCATACAATTGCACTCAAGATGCTTTTCAAATCCCAACTAATAAAACTACAGG
    GCTGGCCCAGACTAAGGATGACTTTTAAAATATTTGTATTTCAAATGGGATGGGAATTCAGATTTTAAAA
    TGATCTCAACATTATAACTTTTGTAATGCCTGTAAGAAAGTTAATCATTAATTTTGGTTTTAGGTCTAAA
    AACAAGCTTTGTTCAAGTAAGACAACTAGGAAAGGCAAACAGAAAGTAAAAGCATTCAAAGTTAAACATC
    TATCATCTTGAAATGACACACTGTATAATTATAAAATAAACAGTGAAGTATCTCAGAAGAGTTTTAGCAG
    GATCATTAATATGCTAAAATAGATGGAGTCCTAGTGGGCCATTACAGGTGTATTCAATTTTTCTCTTTTT
    AAGTACACTTGAATTTGCTACAAGTTTTTTTCTTCCCAGATACGTGAGAGAGCTATCCAGGCAAGAATAT
    ATTTTAATCCATATTCCTGACATTTTGGGCCTACATACAATAGCTGCTTAAAATACTGCTCGTTACATAA
    CTCCCAGATAAGGCCAAACATCCCAATTGGAGTCCTACCTTGAGTCATTGTAAACTTGCCAACTGTTTCC
    AAGGCTGGCTGAGTCTGTTTCCATCCCTCCATCTGGGTTAAGAAAGTCATCTTTTTTGTCCCCATTATAA
    TTTCCACATATCCCACAGACTTTTGATATATAGGCACTGGGAAGAGTGATTTCTGCTCTGTGATCTCCAT
    CAAACTTGACCTTCAGCCCAAAGTCAGTAGTAACCACAACATATTGACCACTGAGGGAAATGCTGACACT
    ATTGCCCAAGGTCAGAGGGAGTACCTGGCTGACTCCATCAACCTACAGGAACAGAGAAGGACAATCAGTA
    TAATCACTTTAAAATACGTATTTTTAATAGTGATTTTCTTAGACCATGTTCCTATACAGAGCATAGGGTT
    TGTACAGTGAACCTGTACTAGCATTAAGAACACACAGTGTTGTGTTTCTGGGTCTTTTTGGGCCTTACAT
    AACATGAATGCTATATGTGGACAAATGACCTTGGGCCTCAAGACCGTAGTAATGCATGTACTTATCTTCC
    AGGTCTTAGCTGTGGTCAAAGTAAGCTTGGTGAACTAGACCCAGCTGGAATAAGTGCAAAAATTATCAAG
    GTCTTTCAGCAGTAACTGCTTACAGGCTTTCGGGATCAAACAAGAGCATGGTATAAGATTTAAAAGATGT
    AGCTAGAATGGAGTCTCAGAAAATTTTCAGGGTTGGACATATTTTGAAAACATTTTTTGTTCCTTTTTTT
    TTCTTTTTTTTTTCCCTCTTCTTTTTCTTTCTTGTTAATTTTCACATGTGAAATGCCAACAGTAAGAAGG
    AAGTGTTCAAATAAAATTTGCAATTTATTTTAAATTCAATAAAACTAACATTCTTTGAATATTTGTTCTT
    ATTACATAATTAATATATATACATTTCAACTTAGAAACATATATAATGAAAACAGTAAATACAGTGAAGA
    GATTGAAAAGAGAAACTTTTGGACAAATGCAGATATCAAGTTCACTATGCATCTAAGTTGTGAAGTCTCT
    GTATATTTAAATCCTTATCTCCTGTCCTATTTTCTTTATAAGAAGAGTGATAATGAAGTAAGGTGATCTA
    TTCAATTACTGTGGGTTTTCAATCAAATGTGTATCTGCTACCTTGGCTCTTCATGGAAATAAGTTATAAG
    GAAGCCTTAAAATACAGCAGCTGGTCCAGTGACACAATCAGAGTGATGTGAGTCATCAGGCAGCCTTTCT
    GGGACTCTCATCTGGCTGTGCTTTATGGCAAGTGCCAGGTATTAAGTGAAATTAGCAGTGATGAGGAACA
    ACTAGAAGTCAGAGATGAGCATGCAGCTTTACAGCCTGGGAAATATCTACCAGCACAAGCTCTGTTAATG
    AAAGGCCTTTTTTATTCCCTGCTGCAGACCAAGTTTAGGAATGGAGGTCAATCTCTGAATGGAGGGCTCG
    CTCACCAACTCCACCCAGAGTATCAGCTCTACTCTTAACTGTTAGGAACACAGAAATACAACGTTTTGTA
    TTTTCTTTCTGTTCTGAAATCTCAATGCTTACTTTAAGGAACCCATAGTACTACTGTTCCCAAATATTTG
    ACTGCCTTCTAAATATTGCTTTATGCTTGCCAAGAGATTTGTAGCCATTGTACTACAATTTCTTCAAAGC
    ATGATTTACTGACAGTAGATAGTGAGATCCAGCCTTACCTTAACAACTCTGTTTTTACCCAGATTGATCC
    TGTAGCCATAAACATCAATGTCCACAGATTGGACATAGGACACACGTTTGTTGCCTCTTCTGTGCTCGTT
    AGCAGCTTCCACGTTGAAGTAGGGCAGTGAGCTGTTGTTCTCACACAGCTTGGAGAGCGTGTAGGTGCAA
    GTGCCCATGAAGTCATGACGCTGCTTATCAAAAGTTAAATAATGAGGATCTCCATGTATAGTGCAAGTTG
    CTTCTGGAGAAAGGAAAACAGAGTATGTTTCATTAAGATATTGGTGCATCCAGAAAAGCCAGCTCATACC
    TTCGTTGTGCTGTGGGAAAACATAGTCATCCCCATTTTATAGGTTACACATGAAAGAACTGAAACAGCAA
    AGACAGATTTTTATGGCCCAAGGCAATGCCACAGAAACACACTCAGATAAGTTAACTCAAGTAACACTGG
    TAGAATGCACAGCTGCCCTTCTCTAAAGCACTGACTATCACATGTGATTTGTTAAAATTACCTGTCACAG
    CAGGTGGTATAGGTGCCGTTGGTGTAGGTGTTGGTGGTACAGGGGTGCTGACTGCATCTGTCAGTAAAGA
    CAAGGTAACAATAATTAGCATTATATAACATTACAAACTGAACACTACATACAAACCAACATACGTAACT
    TTCAACTTACTCTTCACCAGTTTAAAGTTAGAATATCTTCACTGAAGAAAATGGAAGTCTACATTTAAAA
    ATGAGGACTTTAGGTTCTTTTGAATTCTTAGGGAAGCTCATCTGACTACTAGCTTGGTGACAGTGACTGA
    GCTTGTCCTTGCATGATTCTCTGAAACTGGAGATGTATTTACAATTGCATCTGTGATTCTCTCTGGTTTG
    TATGTTAAAGCGTGAAGGTCATGTTCTCTGCAGGCCTTGGCAGGTCTGGAAATGAGTAGCCTGCCAGCAG
    ATGCCATGTAACAGAAACAAGTGACTCTCAGGACACTGGTAGTTACTAATCAGTTTAATTTTTTCTACAA
    AATGGCATTTATTTCTTAGGAATGTAATGAATGTAGGAGCTTTCTGCTGACAGATATTATAAACAGTGAT
    GTTGAGTCTTTGCTGATGTCCATTACTGCTTGTTAATACATATTAATACATATTAGCATCTTCTCCACCT
    ATTCACCTATCACAAAGACATATTCTAAAACAAGTGGTCCTTGTGGTGTATTAGTAAGTGTGTGCTAACA
    ACCCCAAGGTGTACTGTAGGCATAGAGCTTAGCAGAAGGAGGAGCACTTCTCTAGTCTCTTGGGATTACA
    TTAGTGCACCATCCGGTGGCTGAATTGTGTGGTAATAAGCCTGGAAAAATGAACAACTGGCTCTCCAAAT
    GGGCCCCAAGTATTTTTCACAATTTTAAAGAAAATTACATCTTCTGAGGTTATAAACATGAATGGAACTC
    TTCATTATCCAAAAATCCTAGCTAGAATAAATTTAAAACATTTCATTGACATTATATGAGTAGTGTTTTG
    CAGAGATGTCTATTAAGACTTGATGATGTTCACAGCATGTTTCTTGTAGAATTCACATCCTGTGAGTTTT
    GCATTCATAACAGTAAAGATGGGATTAAACTGTAATTCATTTCTGGCTTCAAGTCTTCCACAGACTGTGC
    AACTCTAGACTGATTTATTAGAGGGTCAGAGATCAAACTCGAATTAGTGACGTATAATTAGGTATCACAG
    TGCAAGTCAAAATTATTGATTCAACAATATACTTCTCTTTAATTACGCATGACAGACCTGTGTATTTTCT
    GGCTCATACTGGACAGAGATTAGCTGTAAAAGATATTTAGAACACTGAAACCAGGAGTTGGACTCTATGA
    TCCTTGTGTGTCCCTTCCATCTCAGGTTATCTTATGATCCAAGACCTTGGCTGGGTTTAGAGATGCACTT
    CACACTTAAAGTTTGTTGGACCATGTGAAAATGGTCACATTTACAGAGAAGTGAATGGCTTAGTCTCTGT
    GCTTGAGGCATTGAGGAAAGAACTGGGGAGAATTTACAATAAAAGAGGTAACATTTCTATGAAGTGAGCT
    GGAAAGCCTTTTCCATTTCTCTTCTGCGGCTTGGAGTTATGAAGAGTTTCTATAACATAAATGGAATTGA
    ATAATTGTCAACAGCTTAAAGAGAGATGAGGAAGGCACAAATATACACTTACCACAGGATCCATCTCTTA
    CTCTCACATTGTCCAGTGCCGTATCTGCATACTCTGTCAGTCCTCGGACAGCCTCAAAAATGACCTAGGC
    AGGATGCAAAGTCAATCGCTACATCAATTGTTCAGGCATATGTGAGAGAATTTCCCTCAACATGTTTTCA
    GAATACTCTTTCTGGTCTATTTCTAAGGGCATCCAGGGAACCAATGGTGGAACACTTTCCCCAGTATTCT
    TCAAGAAAAACTTGTAGAAGTTTTTTGTAGAAAAAGTAAGGCACCTAATGTCTTTGACATCATGATAAAA
    TGAGGGAAGGAGGGAATGTGGGAAGGAAGGAAAGAGAGAGCAAATCAAATATATTCTATCTCCTAGCTAA
    AAACACCAGTAAACCTCAGGGAGTTGTTTGTTTTTTCTCTTAGTTTATTTGCACAAAGCATGAGGGCATT
    ATAATTACAAAATAGAAATCAAGAAAATTTTGGTTATTGTTTCTAGCTTATACATACAACCTTTTACAGC
    CTGCAAAGGGAGAGCAAATCATAAATGCTGATGCTGTACAAACAAATTTATTATGAAAATATATTACCTT
    TATCTTTCTCTGTGTTGGAAAAGTATGTGTGACAGCACCATAAATCCAAGAGGAACTTTGGTTTCCCTTC
    CGACTCCATGCCGTTAACTCCCCTGTGCTGTCTTGGATAAGCACTCTCAGTTCATTCCTGTCTTCTGACC
    CAAACATATAGTACCAGAAGTCTATGCATATCTTTTCAGAAACCACAATATCTGGGCTCTCAAGCCTGTT
    AGTGTCGAATGGGATCAGATTGCTTGCTTCTTGGTAGATGAAATAGCCTTCTGCAGAGTGAAAAAAATAA
    AAAAAATAAGTCTGAATCTTTCTAACTTGTTAGGTGTCACTTAAAACTGAGGTACATCTCAACTCTGGAA
    GAAATCAAGCACATCATTAGCAGTACAAAGAAGCAAAGTAGCAAATGATTGTAATTTATACTGCAATGGT
    TAGCACTGTGTAGTTAGCTAAAGTACAATGAGACCTGGAGAGCAAAGCAAATATATCCTATCTCATATGA
    ACAGTTATTTTGGGATTGCAAATAAATATCTAGGCTTCTTTCAAAAGACAGCATTTCCAGACACAGTGCC
    CAACTTATCCTTGTTCAATTTCCACTTTCCTCTGAGGAAAATAATGTGATCTACTATGCATCTGCTATAC
    ACCTTCTCTTGCAAGATACGGTCTAATGATAAACAAATTTTTGGCATAAGGAAAATTCCAACCCCTCAAT
    ATTTGGTTTTGTCTCAAAGCAGAGGGGTAAGAAAAAAAACACACAGATATTTCCATTAAAATGTTAGGTT
    TGACATTATCAAAAGGAATCAATCTTTTCAAAAATCAGAATCTCACAATGTTTGATTTTGGGATTTAAAT
    ACTTTACTTTGAACTTGTTAATTGTGAGATCACATTTTCCTTTACTAAGGCTGGAGCTTTTTGCTTCCTA
    TCACTTCTCTCTGCTAAGATGAAAACTGTATTTTGCCAGTGCAGTTATGTCAAGTCTCTCCCATATGACT
    ATGGAAAGGAGTAAAAAAGAAATGACCATATCTACATTATAAAGCATTACTCCACACACAGTATCTAATA
    TTCAGTCTACTGTTTTAGGGCTCTTTTAATAATAAGAAAATGTAAGTAGCACTTGAAGTTATATGAACCA
    TGCCAATTGAAAAAAATATATACTTATTGTAAGTGACCTTTCCAGTCTAGGGATAATTACTGAAAACAAT
    ATGGCTACAGATTGATCTCCTATAAATGAATCTTCTAGTGCAAGGTTGAAGGTTCTACCATTCCATCTAG
    TGATGGAGCCATATTAAACACTCTTTTAATGATAGGACCACATTAGACCTCAGTTTTTCAATCCCATGTA
    GCTGAGGACGAGTTTTAAATGTATTCTTTGATTTCTGACTGTAATTTCCAATCTTGTAATGCTTTGCTAG
    CATGAACATTATCCAGTGTCAGCACAGTGATCATTACATTTCTTGGCGTCAGCTGATATCACTGTAATTT
    GATTATAAAACTTCTCCTGTGTAATGATCAATTGAATGTCACTGCATTCTCTGTGAGGTCTTAAGCAAGA
    TGTAGTTAGCATGCTTCTACTTGCTTTTACTGCACTGATAAATATTTCCAACCTATGATGGGGAAAGCCA
    GTTTAATCTTGTGACTGAACACGGTGAAAAGTCAAAGACAGGTGTCAACCAAACCGACACATTTCAAAGG
    ATTTCATTAATCTCTTCATGAAAAAGAAAGAAGAAATGTAGACAAGCTGTATTCAGTAAACAATGAAGTA
    AACAATGCCATCAACAAGCACTTACTTCCATCAGGATAGTCTCCATCAGGACCTGTTCCATCTGTTGGAG
    TCTCATGCTTGGTTCGTATCCATACGCCCTGGTTCACAGTGCAAGGTTGGGTCCAGTCACAAAATGGTCT
    TGAGTTGTTGTTAAAATCACATCGAGTGAGGTAAGCTGAAATGCAGAATAAGGTAAGTAAGGAAAAGGAG
    ACACTATATTCAAAACCTGCCTTGGACATTAACAGCACTAAGTATAAACAGTTACCTGTTGCAGGATCCC
    ATGATCTCAAGCCACCGGTTGGTCTGTGTTTGATCCTGCCAAGAAAAAGAACACAGTGATATCCCTACAG
    ATTTAGTGACACAAAAACTGTTTAAGAGTGTAGAGACTAACAGAAGTCATCAGGTGTTCTTAATGAATCA
    CTGCCCAGACTCAGGGTCTCATCTGTGTCTGACTCCTTCCCTTCCCATCTGTCCTTACTCCTTCATTAAG
    AAGTTCTGAGAGCTAGAGAAAAAGTGTGATATGTTCACCTCATCTGAGTATAGAGGGATCCTCTCCCTGT
    ATCTCTCTAAAGTGAAGGGAGAAAGTTCTACTAGGCACAGGGAGCAACAAGAGAGATGGCAAGGTACAGC
    AAAGTTCGGATAATACCAGAATAACACAAAAGACTTGCTATTAACTTGTTTGTAGCACTGGCATCCTCAC
    TACTGCTAAGCAAGATACGTAAACGCCAGTAAACTGGTGTGTCACAAAACTGTTATTTGTCAGAAGGCTT
    ATGTTTCCTTTAACCACAACAAATATCTCATGACCACAAGCTGCCATCTCATTTAGTTTCTCCTGTAAGT
    TATCCTAAAAATGCTACAGGGCAAGGGCAGTTAGAAATAGATATAGTCCCTTTGGTGCTAGAAAATCCTG
    CAGAGGTGAGATGACATAAAACCAAAGCTCTGTCGCAGATCATAAGATGGCTCTATTCATTGGGTGTTTT
    GCATCAGAAAGGGATTTCCAGGACTGCTAGACTGCAGTAGCTGCTCTTGACATGTTCTGATGGTGGTCTA
    CAGCTTTAGGAGGCAGGGTCCAGTTCCTATCCCTGTGTTGCCCACCATCCCTACTGTCCTTGTTGTACCT
    GACACAGTATAGAGAGAATCTGTCCTTAAGCAAAGCCATCACAGCAGATGTCCCCACAGCCCATGAAAAT
    CTAAGCAGAGAGATTCAGAAAAACTAGGGGGATTCATAGTATCATATACAAACAGGATCTACTTCATCAC
    TGAAACACACCAAACAACTGGAAAACAGACGAAGCTAAAGCTAAGGAGGAGAGAGGTGTGAAGATAGGTG
    AAGTGAGAACATTTTCTTCTTTCCCCACAAGACAGCTGTAACAAGATGCCATTTAATCTCTATTCTATGC
    TATCTTTAAACCGCTATATATCAAAGTCCTAAGGCAAAGGTTATTGTAGATATACTTAGAAAGTCACAAA
    CATTTGATAACTGCAGCAGATCTCCCCTTTGGTTCAGCCATTAGAAATGTACAGTTTACACATTCTCTCA
    CAGACAGCAACCACTGCAAAACTTGGCAATAACACAATTCAATTATTCCCTCCTTTTAAAAATAACATGG
    TTTAATCGTACAGCATTCATGTGTAAAAAGATGAGAAAGGACATTTATAATTAACAATAACTACGTTTCC
    TGAACTAAGGTAGATTCAGCATTGTGCTACTTACCCTGTGGTATTCAGCACCAAAATACAGAATAAAATC
    AAAATGCATTGTAAGTGCCAGAGGGTCCCCATGCTAGAAGACAGTCAAGTCTTCTGTGTGGTACAGTCTA
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): Mycoplasma gallisepticum lpd mutant vaccine
IV. Vaccine Information
1. Avian Encephalomyelitis-Fowl Pox-Mycoplasma Gallisepticum Live Fowl Pox Vector, Live Virus Vaccine (USDA: )
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0004206
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
2. Fowl Pox-Mycoplasma Gallisepticum Live Fowl Pox Vector Vaccine (USDA: 1D51.R0)
a. Manufacturer:
Biomune Company
b. Vaccine Ontology ID:
VO_0002201
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
3. M. gallisepticum TM-1 Protein Subunit Vaccine
a. Vaccine Ontology ID:
VO_0011515
b. Type:
Subunit vaccine
c. Status:
Research
d. Gene Engineering of TM-1
  • Type: Recombinant protein preparation
  • Description:
  • Detailed Gene Information: Click here.
e. Adjuvant: aluminum hydroxide vaccine adjuvant
f. Immunization Route
Subcutaneous injection
g. Chicken Response
  • Host Strain: SPF
  • Vaccination Protocol: Eight-week-old specific pathogen-free (SPF) chickens were immunized subcutaneously in the right thigh with the TM-1 polypeptide, suspended in a mixture of 1 ml of PBS and 1 ml of an aluminium hydroxide adjuvant (Saito et al., 1993).
  • Challenge Protocol: Four weeks later, the immunized chickens were challenged intranasally with 0.5 ml of a suspension of 106 c.f.u, ml- 1 of M.g. KP13 strain 27 (Saito et al., 1993).
  • Efficacy: Only one of five immunized chickens harboured viable M.g. cells in its sinuses after being killed 5 days after challenge with M.g. (Saito et al., 1993).
4. Mycoplasma Gallisepticum Live Culture Vaccine (USDA: 1751.00)
a. Manufacturer:
Intervet Inc., Lohmann Animal Health International, Merial, Inc.
b. Vaccine Ontology ID:
VO_0001702
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
5. Mycoplasma Gallisepticum Live Culture Vaccine (USDA: 1751.01)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0001703
c. Type:
Live vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
6. Mycoplasma gallisepticum lpd mutant vaccine
a. Vaccine Ontology ID:
VO_0002857
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Chicken
e. Gene Engineering of lpd
  • Type: Gene mutation
  • Description: This lpd mutant is from Mycoplasma gallisepticum (Gates et al., 2008).
  • Detailed Gene Information: Click here.
f. Immunization Route
Intratracheal immunization
g. Chicken Response
  • Persistence: An lpd mutant is highly attenuated in chickens (Gates et al., 2008).
  • Efficacy: An lpd mutant induces significant protection in chickens from challenge with wild type Mycoplasma gallisepticum (Gates et al., 2008).
  • Host Gene Response of IgG Fc fragment
    • Gene Response: Mg 7 vaccinated chickens mounted a strong humoral anti-M. gallisepticum-specific IgG response that was sustained for at least 4 weeks post-exposure. M. gallisepticum-specific immunoglobulin responses were detected in chickens inoculated with either Mg 7 or R(low) but not in chickens that received 1× PBS alone. The level of M. gallisepticum-specific serum IgG was highest in the R(low) treated animals at both the 2- and 4-week time points, however, the Mg 7 inoculated birds mounted a fairly robust response considering its level of attenuation. Thus, the Mg 7 vaccine induced significantly higher IgG responses than PBS inoculated chickens, but significantly lower than those inoculated with wild type R(low) (Gates et al., 2008).
    • Detailed Gene Information: Click here.
7. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B5.10)
a. Manufacturer:
Lohmann Animal Health International
b. Vaccine Ontology ID:
VO_0002275
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
8. Newcastle-Bronchitis Mass Type, Killed Virus Vaccine-Mycoplasma Gallisepticum Bacterin (USDA: 48B6.10)
a. Manufacturer:
Wyeth, Intervet Inc.
b. Vaccine Ontology ID:
VO_0002276
c. Type:
Inactivated or "killed" vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Chicken
9. Porcine Rotavirus Modified Live Virus Vaccine-Clostridium Perfringens Type C-Escherichia Coli Bacterin-Toxoid (USDA: 49C1.21)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002308
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
10. Porcine Rotavirus Modified Live Virus Vaccine-Escherichia Coli Bacterin (USDA: 49K1.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002315
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
11. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Bordetella Bronchiseptica-Clostridium Perfringens Type C-Erysipelothrix Rhusiopathiae-Escherichia Coli-Pasteurella Multocida Bacterin-Toxoid (USDA: 49T9.21)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002319
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
12. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Clostridium Perfringens Type C-Escherichia Coli Bacterin-Toxoid (USDA: 49B1.21)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002307
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
13. Porcine Rotavirus-Transmissible Gastroenteritis Modified Live Virus Vaccine-Escherichia Coli Bacterin (USDA: 49P1.20)
a. Manufacturer:
Intervet Inc.
b. Vaccine Ontology ID:
VO_0002318
c. Type:
Live, attenuated vaccine
d. Status:
Licensed
e. Location Licensed:
USA
f. Host Species for Licensed Use:
Pig
14. Vaxsafe MG
a. Tradename:
Vaxsafe MG
b. Manufacturer:
Bioproperties
c. Vaccine Ontology ID:
VO_0001181
d. Type:
Live, attenuated vaccine
e. Status:
Licensed
f. Host Species for Licensed Use:
Chicken
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
Live temperature-sensitive mutant strain; eye drop administration(Barbour et al., 2000)
V. References
1. Barbour et al., 2000: Barbour EK, Hamadeh SK, Eidt A. Infection and immunity in broiler chicken breeders vaccinated with a temperature-sensitive mutant of Mycoplasma gallisepticum and impact on performance of offspring. Poultry science. 2000; 79(12); 1730-1735. [PubMed: 11194034].
2. Gates et al., 2008: Gates AE, Frasca S, Nyaoke A, Gorton TS, Silbart LK, Geary SJ. Comparative assessment of a metabolically attenuated Mycoplasma gallisepticum mutant as a live vaccine for the prevention of avian respiratory mycoplasmosis. Vaccine. 2008; 26(16); 2010-2019. [PubMed: 18342996].
3. Merck Vet Manual: M. gallisepticum: Merck Veterinary Manual- Mycoplasma gallisepticum Infection [http://www.merckvetmanual.com/mvm/index.jsp?cfile=htm/bc/203402.htm]
4. Saito et al., 1993: Saito S, Fujisawa A, Ohkawa S, Nishimura N, Abe T, Kodama K, Kamogawa K, Aoyama S, Iritani Y, Hayashi Y. Cloning and DNA sequence of a 29 kilodalton polypeptide gene of Mycoplasma gallisepticum as a possible protective antigen. Vaccine. 1993; 11(10); 1061-1066. [PubMed: 8212828].
5. Wiki: Mycoplasma gallisepticum: Mycoplasma gallisepticum [http://en.wikipedia.org/wiki/Mycoplasma_gallisepticum]