VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Eimeria maxima

Table of Contents
  1. General Information
    1. NCBI Taxonomy ID
    2. Disease
    3. Introduction
  2. Vaccine Related Pathogen Genes
    1. gam56 (Protective antigen)
    2. gam56 (Protective antigen)
    3. gam82 (Protective antigen, Protective antigen)
    4. gam82 (Protective antigen)
    5. mic2 (Protective antigen)
    6. mic7 (Protective antigen)
    7. TFP250 (Protective antigen)
  3. Vaccine Related Host Genes
    1. IL15
    2. IL2
  4. Vaccine Information
    1. CoxAbic
    2. E. maxima DNA vaccine pcDNA-Gam56
    3. E. maxima Gam82 protein vaccine
    4. E. maxima oocysts with Arlacel A vaccine
  5. References
I. General Information
1. NCBI Taxonomy ID:
5804
2. Disease:
Coccidiosis
3. Introduction
Eimeria spp. are obligate intracellular apicomplexan protozoan parasites and are the cause of intestinal coccidiosis. Infections of the vertebrate host with these parasites result in the induction of potent protective immune responses, and protection against challenge infections is confined absolutely to homologous species, even though both T- and B-cell responses exhibit cross-species reactivity. Eimeria maxima is the most immunogenic of the seven species of Eimeria that infect the domestic chicken (Smith et al., 2002).
1. gam56
  • Gene Name : gam56
  • Sequence Strain (Species/Organism) : Eimeria maxima
  • NCBI Protein GI : 25989587
  • Taxonomy ID : 5804
  • Gene Strand (Orientation) : ?
  • Protein Name : 56 kDa gametocyte antigen
  • Protein pI : 4.61
  • Protein Weight : 51819.73
  • Protein Length : 539
  • Protein Note : tyrosine and serine rich gametocyte protein; involved in oocyst wall formation
  • Protein Sequence : Show Sequence
    >AAN05087.1 56 kDa gametocyte antigen [Eimeria maxima]
    MTRLGLAAVALALAVGPSMAVPSTTPVENQVHPYSEMSTYQEGSAPGAPEDTTTTTTSSPVSDGAEQWLE
    SFVRAVQRQLQLQDQMMRQLMRDIQEYLSTAFNWAENQSTAYTRVTEMMDMISNRMNAAMDSSNELMTTS
    DTTDPETLRRATRKYMKEVRVQDVLVDALWASLRGVQTAAWMNGVTAIEKEETTPMASRAAEEFLHRMYH
    NLRAAGMSEEDVAKFIPRAEYNPSEQSRNMGRKGRSFYYGGYPSYYNSPYYSYSSYPSYYNYSYPSYSYS
    SYPSYYRYSSYPYYNYSYPSYYNYGSYPYYSYSSYPSWYWRRLRSLATATCPDCPPLTTPSMIPTPPPMM
    NMMNTPPPMANMMTSMMMNTPMVPPPRTLGTEAMSLGLAPIGITGAPMTGFGVPPEFGPFGAEGIGLPTD
    ALGSTPEMTPFDPTTPYRTLAPMDLPPIPPPVFPETPMRPPTPFGFGPAPVPPMPF
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): E. maxima DNA vaccine pcDNA-Gam56
2. gam56
  • Gene Name : gam56
  • Sequence Strain (Species/Organism) : Eimeria maxima
  • NCBI Protein GI : AAN05087
  • Taxonomy ID : 5804
  • Protein Name : 56 kDa gametocyte antigen
  • Protein pI : 4.61
  • Protein Weight : 51819.73
  • Protein Length : 539
  • Protein Note : tyrosine and serine rich gametocyte protein; involved in oocyst wall formation
  • Protein Sequence : Show Sequence
    >AAN05087.1 56 kDa gametocyte antigen [Eimeria maxima]
    MTRLGLAAVALALAVGPSMAVPSTTPVENQVHPYSEMSTYQEGSAPGAPEDTTTTTTSSPVSDGAEQWLE
    SFVRAVQRQLQLQDQMMRQLMRDIQEYLSTAFNWAENQSTAYTRVTEMMDMISNRMNAAMDSSNELMTTS
    DTTDPETLRRATRKYMKEVRVQDVLVDALWASLRGVQTAAWMNGVTAIEKEETTPMASRAAEEFLHRMYH
    NLRAAGMSEEDVAKFIPRAEYNPSEQSRNMGRKGRSFYYGGYPSYYNSPYYSYSSYPSYYNYSYPSYSYS
    SYPSYYRYSSYPYYNYSYPSYYNYGSYPYYSYSSYPSWYWRRLRSLATATCPDCPPLTTPSMIPTPPPMM
    NMMNTPPPMANMMTSMMMNTPMVPPPRTLGTEAMSLGLAPIGITGAPMTGFGVPPEFGPFGAEGIGLPTD
    ALGSTPEMTPFDPTTPYRTLAPMDLPPIPPPVFPETPMRPPTPFGFGPAPVPPMPF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Xu et al., 2013)
3. gam82
  • Gene Name : gam82
  • Sequence Strain (Species/Organism) : Eimeria maxima
  • VO ID : VO_0011062
  • NCBI Protein GI : 38565038
  • Taxonomy ID : 5804
  • Gene Strand (Orientation) : ?
  • Protein Name : 82 kDa gametocyte antigen
  • Protein pI : 4.8
  • Protein Weight : 63301.57
  • Protein Length : 661
  • Protein Note : tyrosine and serine rich gametocyte precursor protein; involved in oocyst wall formation
  • Protein Sequence : Show Sequence
    >AAO47083.2 82 kDa gametocyte antigen [Eimeria maxima]
    MTRAAALAGVLALAAAGSSLALPTVLDTTTGTQVEWTETPLDTTEVTMGEMGSTTSGTTPTSTGVRMMEA
    ETTTPSTPEAPQQQQQMPQPQPQPQQTTPVPEAVLEAIMQEMQNIFRSSLVPGWDTVGTAADAVRQIVTR
    VRERLTGPLMMTEMDTGLGRTGPLSTTGATGATTGPVAALRGVTNDFLREIMIQEAVLETLWAVVRDAQE
    RPWLVNEQEALHAATADAVQGFLGRMHDRLRATGFSEEEVMRLLPRSRNGGCTRTGGLFDQCNDAPPSRL
    LGKRMYSTGYYGYGYPSYYSYGYSYPAYSHYPVSYPYYGYSWGPSYYYGSGYYGKHGYKYGHYYRRLAEQ
    EPRPVMPPAAATAAANLRAAAAAAAEVPPPPPPAAVPPPPPAAAAGTPAMMPPPMMGVEEPVPFRSLYPS
    YSWSYPAYTRVSPSYSYYTPSYSSSYYYPRYNYAYNYPLYSDYSWYDYSYPLAYSSYSSYPLSYSSYSYP
    LSYTYPSAFYRRLEVPDLTTTTTTHHEQQQQQQQESTTTAVPTETITTPSTRNTHSSSLRRVGERYEPIT
    PTQRTFYNNTEGTNNPVYTPENLTEDEPQTVWETYN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Animals vaccinated with Gam82 and challenged with E. maxima showed lower oocyst shedding and reduced intestinal pathology compared with non-vaccinated and parasite-challenged animals. Gam82 vaccination also stimulated the production of antigen-specific serum antibodies and induced greater levels of IL-2 and IL-15 mRNAs compared with non-vaccinated controls. These results demonstrate that the Gam82 recombinant protein protects against E. maxima and augments humoral and cell-mediated immunity (Jang et al., 2010).
  • Additional Molecule Role : Protective antigen
  • Related Vaccine(s): E. maxima Gam82 protein vaccine
4. gam82
  • Gene Name : gam82
  • Sequence Strain (Species/Organism) : Eimeria maxima
  • NCBI Protein GI : AAO47083
  • Taxonomy ID : 5804
  • Protein Name : 82 kDa gametocyte antigen
  • Protein pI : 4.8
  • Protein Weight : 63301.57
  • Protein Length : 661
  • Protein Note : tyrosine and serine rich gametocyte precursor protein; involved in oocyst wall formation
  • Protein Sequence : Show Sequence
    >AAO47083.2 82 kDa gametocyte antigen [Eimeria maxima]
    MTRAAALAGVLALAAAGSSLALPTVLDTTTGTQVEWTETPLDTTEVTMGEMGSTTSGTTPTSTGVRMMEA
    ETTTPSTPEAPQQQQQMPQPQPQPQQTTPVPEAVLEAIMQEMQNIFRSSLVPGWDTVGTAADAVRQIVTR
    VRERLTGPLMMTEMDTGLGRTGPLSTTGATGATTGPVAALRGVTNDFLREIMIQEAVLETLWAVVRDAQE
    RPWLVNEQEALHAATADAVQGFLGRMHDRLRATGFSEEEVMRLLPRSRNGGCTRTGGLFDQCNDAPPSRL
    LGKRMYSTGYYGYGYPSYYSYGYSYPAYSHYPVSYPYYGYSWGPSYYYGSGYYGKHGYKYGHYYRRLAEQ
    EPRPVMPPAAATAAANLRAAAAAAAEVPPPPPPAAVPPPPPAAAAGTPAMMPPPMMGVEEPVPFRSLYPS
    YSWSYPAYTRVSPSYSYYTPSYSSSYYYPRYNYAYNYPLYSDYSWYDYSYPLAYSSYSSYPLSYSSYSYP
    LSYTYPSAFYRRLEVPDLTTTTTTHHEQQQQQQQESTTTAVPTETITTPSTRNTHSSSLRRVGERYEPIT
    PTQRTFYNNTEGTNNPVYTPENLTEDEPQTVWETYN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Jang et al., 2010)
5. mic2
  • Gene Name : mic2
  • Sequence Strain (Species/Organism) : Eimeria maxima
  • NCBI Protein GI : CBX60033
  • Other Database IDs : CDD:115333
    InterPro: IPR009556
    UniProtKB/TrEMBL: F6IA05
  • Taxonomy ID : 5804
  • Protein Name : Microneme protein 2
  • Protein pI : 4.65
  • Protein Weight : 28403.732
  • Protein Length : 350
  • Protein Note : Microneme protein Etmic-2; pfam06670
  • Protein Sequence : Show Sequence
    >CBX60033.1 Microneme protein 2 [Eimeria maxima]
    MARALSLIALGLLFSLPSTSAVRTKVPGDEPSGPDSALTAGSPTRGNHGVGGFAEAHCNRLTVRGGLQEK
    EAVKVTANGWGKGDADFFVELVTDNTRGMLQIRESQTEAGPGLAGGGGQEGGSTEGSKTDEGPVKEQPSI
    PIVGVRIPGSANENGESRKPAVLVYGEGESAPKEFPLDSPAGPTSPFMVVLQQKSPTEMTVRLFTWIPNG
    SGGDGSWHETFVDVGVGINHRDVMVVVSDCVPHSLRIYGSSSADLVTADEKTCQATEPQLVNLTSPPENR
    THPGAETSTTTSVSS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Huang et al., 2015)
6. mic7
  • Gene Name : mic7
  • Sequence Strain (Species/Organism) : Eimeria maxima
  • NCBI Protein GI : CBX60037
  • Other Database IDs : UniProtKB/TrEMBL: G0LEU8
  • Taxonomy ID : 5804
  • Protein Name : Microneme protein 7
  • Protein pI : 4.27
  • Protein Weight : 16737.882
  • Protein Length : 225
  • Protein Sequence : Show Sequence
    >CBX60037.1 Microneme protein 7 [Eimeria maxima]
    MRSFGAISAILAFCLSSAEANSGLKWVTWPENGSIKFSTPAAPQRLAVDVVDCMKVDVNFPENLVKVELP
    SGESLELTSGERLQPNGGQLVVLFSSFGGQGHVIVNGEDVAGGFDTRMSSFAVPECFISRVRVTSPDGGE
    LPSESLVAISEEIVNNFKKSYGAQSVNVEQSA
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Huang et al., 2015)
7. TFP250
  • Gene Name : TFP250
  • Sequence Strain (Species/Organism) : Eimeria maxima
  • NCBI Protein GI : AAO52676
  • Other Database IDs : CDD:294047
    CDD:284955
    CDD:238011
    CDD:289699
    CDD:214542
    CDD:301595
  • Taxonomy ID : 5804
  • Protein Name : TFP250
  • Protein pI : 3.92
  • Protein Weight : 238316.96
  • Protein Length : 2431
  • Protein Note : Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of...; cl00057
  • Protein Sequence : Show Sequence
    >AAO52676.1 TFP250 [Eimeria maxima]
    MLHRNPRWALCAALAALYGGTGIASAEVNNELSKCESGWTPWTTCNPQTGLRERHNAQCETWVEVEECQK
    LTGCGNWTPWSPGDMSCVVGQFQTRNREGCPEVQEVRACRPVLLECNDQWTPWTMCDTNRVQERYNSKCG
    PVEVRECNMDDAEIEKCGEFVEWDPPMNGDCVRGGTHTRYRQNCPDRKEVRVCGAFDCSSCSVNATCDPI
    GASCECKPGFRGNGKTCEAFNPCEDTPAPCDSNAICTPDGNDAKCQCKAGWDADSGAGSSKKPCVEVDEC
    ASNTHQCPAHSTCINTKGSYKCDCNQGYVKGEDGQCHDVDECTNGEHTCPAHSTCLNTAGSYECRCDTGY
    SGNATADSPCKNIDECANPNACSANAICTDTDGSFTCSCPEGYSGQGTHDSPCSKIDFCADPSLNTCGAH
    STCVNTLTSFKCICDAGYEGAGTRESPCVDVNECSNEKPTNNCNRNANCTNTEGSYTCECKPGFSGDGMG
    PNGCTDIDECAAEQSPCDPHASCSNTEGSYVCTCNTGYEPASTDGHACKDIDECATGAAGCHVSAQCLNT
    DGSYECKCLEGFVGDGKTCNDVDECAAATSPCGDNTHCQNTIGSYECECKAGYGNMQDNACSDIDECKDA
    NTKIPDNCLCVNNDGSYSLEAKAGYELVNGECIKIDFCARGACNSLASCKENEEGTAAICTCLPGYSGDG
    TAEGHCNDIDECAGQNDCAPAEQGGICENTVGSYTCKCKEGYRQDGNSCTEIDECAEGTHNCHPSATCSN
    TPGSFTCQCNSGFTGSGVECEDIDECSTEADDCGANTICSNTIGAFECNCREGYERADAKTCVDIDECAT
    GTHTCSNHATCTNTDGSFTCQCNPGFEGDGHKCEDIDFCGAGQHDCNVHAECSESEDNTTFKCTCITGYA
    GDGHGEAGCQDIDECAEENICGSNAVCTNTAGSYQCACREGFVASAEQQQQGTPALVCVDVDECSDASKN
    TCAKPADGGICTNTEGSYECACKPGYQGDGHSCADINECTAQGTCGEHTTCKNTPGSFQCDCVEGFERAD
    ERTCRDINECETGAVVLPPNSTCVNTEGSYDFDCVAGYRRTDGACVKIDFCKEKGCNANATCRENDAGTE
    AICTCKEGYEGSGEGEDGCQNINECERGEPCKDFGEGGVCVDTPGSFTCECAAGFIQRRSVCQDVDECLD
    GKLNTCAATGGVCSNTVGSFTCSCASGFEGDGHTCNDVDECATAQHTCDPNATCVNTEGSFECRCNAGFE
    GDGHTCADIDECADPAKNTCDTHKGVCQNTTGSYTCGCKTGFSLAADGSTCENVDECAAGTANCNERSFC
    KDTEGSYQCECKNGYKAAGEDCVDVDECEAGVHGCSEHAICTNTDGSYSCECMEGYQGDGKACEKTVGVC
    DSAPCGAHATCEPAGDNYTCTCHPGYEMREGACVDIDECTAGSLNCDPHAICTNTDGSFTCVCGSGYTGL
    GTSCEDIDECAGNAAGCDIHAVCTNTPGSFKCECKSGFEGDGTQCTEKVLLPGQIHCEAWTAWTECTDGA
    KTSTRSCLALPLKKEMRACPAADFSQCGEFTEWTACPGTNNNLSHRRTERFGEPGCEDAEEVRECPDEET
    EQKCGAWGEWTACGDPSPGLRTRARENCPDVVEFERCTMPSEPEAGEVTEPHTEGGAGVGGEVTEPDTEE
    GAGVGGEVQPGTEEGAGVGGEVQPGTEEGAGVGGEVQPGTEEGAGVGGEVQPGTEEGAGIGGEVTEPDTE
    GGAGVSGEPTEEEGTESTGPCKEFGPWTACKEDENGVGIQRRMCAGREDIIESRICTVTDDCGEWTPWST
    CTNGSQARNKRFCTNVREVRLCGADIPVTDGCTWSEWTSCSLVNEEGGYFRTRTSSDCNMNEVQACSPSS
    STTADSETEGTCSAWNPWTECSNGHQTRKCATMEAEESRTCGETPENCGEFGPFEPANCTAGQMVTRTRT
    CGETEQKETKLCDVSSTEEGKQCGQWGPWSECNIHLGSEDNVRVREDTACGVTEYEECSKPANNAFVCTP
    WSECSDKKERRTCTIRKNGLVQTRQEFRTCSVDIATTCGDFGAWSECNAEGLHQRSLEKCPDVIEVATCG
    SEDCPPFGEWTECGVPEEGMRSRQRIDCVESAACQCTEVESCFDTELHPIPAPGTETGEGEGETETGEGE
    TGEAGGEEGEQTGEGEVQPPEEELPGESVTEPEEKPEEELPEEEVTEPEEKPEEGVTQPEETPEQPVEGT
    EEEGKQESEAAPETPAVQPKPEEGHERPEPEEEEEKKEEGGGFPTAAVAGGVGGVLLIAAVGGGVAAFTS
    GGGGAGAQEAEQVEFEGEDTGAATAETPEADTVIDITDEDDYWADSGDIQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : (Witcombe et al., 2004)
1. IL15
  • Gene Name : IL15
  • Sequence Strain (Species/Organism) : Gallus gallus
  • NCBI Gene ID : 395258
  • NCBI Protein GI : 45383037
  • Genbank Accession : AJ416937
  • Protein Accession : NP_989902
  • Taxonomy ID : 9031
  • Chromosome No : 4
  • Gene Starting Position : 29463695
  • Gene Ending Position : 29495838
  • Gene Strand (Orientation) : +
  • Protein Name : interleukin 15
  • Protein pI : 8.34
  • Protein Weight : 21070.54
  • Protein Length : 187
  • DNA Sequence : Show Sequence
    >gi|358485508:29463695-29495838 Gallus gallus breed Red Jungle fowl, inbred line UCD001 chromosome 4, Gallus_gallus-4.0, whole genome shotgun sequence
    CACCAGTGCAAACTTTATCCTAGTTTCCGTACCAACTTGCTCCATAGGTTTCCGAGGCTTGTAAGTATTT
    TACAAACTTTAACATCCTCTTGCTTTTTTAAAAAATTTCTTTCTTGAATTAAAAGAATGAGGGAATTTAT
    ACTGTTTAGCTTCAATTATTTTTTTTTAGTTGCCTTTTAAGACTGTTATAAATGTAAGAGACATACTTCA
    AGTATATCTGACCACCTACCTGGTGTCTCTTTCACCATTTCTCCTGTAGGAGAGGCATTAGATATTATGG
    AAAATTGGTGCTAGTCAGTGAAAATTTGTCACTGTTTATTAACAAACTCACAAAGCAAAGGAGGAAAAAA
    AGACATTTCTGTGAGACTAGTGAACATAGCAAAGAGAGAGAGAGAAAAGACTGGGAGAAAAATTATTTAC
    CAACCTGATGTATACTCTTGAAAGAACCATAAATATATGTATGGGACTGAAAACGGCAGTCAAGTGGAAT
    CCTACTGAAAATGGTGTTATGGAGACAGAGTAGCTGATAGCAATGTACTATGAAAGTATTATCTGGTTAT
    TAAGCCAACTAAACAATTGCATTCATGAATTTGCTGTTCAAATAACACTTTCTGCAAAATGAAATCCAAA
    AGGAAGGAGGAAAAGGACATGTAGGGGAGGAACTTGTGAAGGACTGTGATTTTAAGACCTGCAAAATTAC
    CTCTGTAAAAGCCAAAAATTCTCCTAACTGTGTATGTACATAATATTTATGATTTCTTCTATATACAGCA
    GATATATATGTGCTGCTTTCCTTTAAAACAGTGTGATATTGCAGGAGAAATTCCTGATTATCATTACTTC
    ATTATGTTTTGCTGTACTTTCCAGATAGACAATAGCACAAAAGTTCCTTTGCCCATTATAAATGTGTTCA
    TTCCTACTTACAGTTACTAATTTATTTGAAATGTGCTAGCCAAATGGAAAGGTACCACTTAGTTATTTTC
    TCTTGGAATGATATATATAAACATAGATCGACTTAGTATAAACAAACAGAGGTATAGAATTACTTCCTTT
    GGAGTCTATTGGACTGTTCCGAACTCCAAGAATATAAGCAACTTTATAGCCTATCATAATTACTTTAGCT
    TTGCGGATTCAAACAATAAGGATCACCTTCGCCAAATCCTCAGAGTGTAACATTATCTATCTCACTGCCT
    TTAAAAGTGTTTGAACTCCCTGGGGAAAAAGAAAATTATTGACAATTCCACTCTAAGGTGTCCCAGACTT
    TGACTGAAAATAGAAAAGGATTGCAGAGAACAGAGACACGGGCTGATGTGGAGTTATTGGGTAGTATAAA
    TAATATGCTAGATTTTTTTCTGACGGATTAGATGTCCCATCTCACTTCAGCTTGCTGTTACGCGCCTTTG
    CATGAACATTTTCAAGGCTGTGGCCAGTAATATATTTAATACAGACTTTCTACTGTCAGGTGCACAGTTC
    TCACAAATACCTTTCTCTGTGTTCATCTCAGAATGTTCAGCTTTATGCAGCCAGCACAGGAAGGAGCAGA
    AATATGTGGGAACTGTTCCTCCGTGTTCTGTCAAAAATGGTGTAAAATAGATCATTTCCACAGGGAGAGG
    CTAGCACAAGGTATGACTTTCAGGAATAAGGAAAGGCTCAATAAAAGACAGCAGCCCAACCTCAACTGTT
    GGAATAAATTTGTTAGTCTGTGCATAAGTACATTTTTTATCCCTATTGTTTTTCTACACGACAAGGTCTT
    GTTGCTTGTAACTGGTACATGGTAACTGTTTTTTGGTTGCTGTCTTAATAAAAACAAATTTTATCTATGA
    GATCTTTTAGGACAAATTGGAATTATTTTTAGGAGCTGTTAAATTCTGAGTCTCCTAATCTTGATGAGGC
    AAATCTGGCTATTTTTTCTATTACAATTTTATGATGTTATTACCCATAAAGGTACACGCATTAACAAAAT
    TGTTCAATATCACTGTCATAGACAGATCATTACTAGTGATGATCTTTTCTGCACAGGCCATCATGACACG
    GTAAAACATACTGTGCCTGAAAATGGAAATCCAAGCTGTTATCACAAGTCTATAAATACTTCTTGGCTCT
    CAGTGTGAAGTTGTAGTGAGTTGTATACAACTGAGGTAGCAGGCAAAAATGTCACTGCTTGGGATGGCAA
    GCTGCCTTCTGTGTTTGTCAGTCCCTAGCCTGCCTTTTAAATTACAGACGTGACTTTCCCTGAGTTTCTG
    AAGTTTGAAAATTGCTCAGAAATGGAGAGGACAAGTCCCTACCATCTGTTATTTGTTATCTGCTATTTAT
    TACTCTGAGAAATGTATATGAAGCACTTATTTATATATAACTTATATTTTATAAGTACTTCCAAAATTTT
    AATTTTTTATTTTCACACAGCCCATATTTCCAGTTTCCATTCTACAGATTTTGCTAAGACAGCAGATGAC
    TCTGGGAATAAATGCTGACATATTTTCAAAGTTGGCACACTTCTCTCTGCAAGGACCAAAGTTGAGTACA
    AAGCACTGCTAGCGGATCATGGGAAAATTTGCTCAAAGGTCCCCTTTAAGCAGGAGTTCAAAGAAATGAA
    ATTATATAGCAAGTCCGCAGTACCTCAACACACAGATTATTCTTTCATAGAAAAAGGGGCCTCCAATTAT
    ATGTAACTGATCCCAGAACAAACTTACTCTTTCACCATTTCCTTGCTGAACAATGAACCTTAGTTGCTGA
    TTTCAAAGGTTCCTGAATAGTGAAGGACCTTCTGCTCTTCTTCAGCCAGTGCTGTTACGAAAGCTGGTGC
    TATGGTCCCATGCTCAGAATGAATCTGAAGGAAGAAACATTGCAAAAAGATATAATTTTCATCAAAGCTG
    TCTGTACTATCTCAGTGTAAGCATAGATCTCACATAGACAGGATCACCTTTTAGATAATATTCTATAATT
    CTCTGTGAGAGGTCTGGGCTGGGACTTCACTTTAGCTCCATCAGGATTCATGGGTAAAATAAGGCTAGTT
    CTTCAAGAAAATGATTCCTCCTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTT
    CTCTCTTTTTTTTTTTTTTTTTGTGTGTGTGTGTTTGTGTGTGTGTGTGAAAACAAAAACAAAACAAAAC
    AAAAAAAACAAGGGAAGAGCAGAAGTATTTGCAAGCAATTTATTTGCCAGCAGGAGGTTTAGCATATAAT
    TAAACTGTTGTCCTTGCTGGTAGGTTATTACCAGCAGGTAACAAACCATCTTACGGTATTTCGTGCTATA
    ACAGATGAGATAGGTCTTTAATGGTAGCAAAGGGTGATCACTTAGAAATTGTTGTGACTATAGCTGCTAT
    AAATTGCGATCTATAGTTTAATAGTTCAACAATTAACTCTACCACTGACACTCAGAAGCCCTTTTATAAA
    ATCCTCTGATTATCCTCCCTGTCCCTCTGTGGAACTGTTTTTGAAAACCTGCTTTATAAAAATACCTTTA
    GACTATAAGGTTAGACTCTATGACAGATAAAAGTCTTATATCAAAGTTGCTAGACCAATACAGCCATGAC
    TAGAATTTGTTGTATGTTTGGAGTGCCTTTTTAAATATAAGAAAAAGGCCCTTTCATAAATAAAAATTCA
    AATGAAACAAATATACTGAATGCAAATTGTTTTTGAGTAGAGAGAGTGCCATACAGTGAAGAACTAGCCA
    ACAATGTCAATTACTGCACCTTTCTCTGCCTGTAATACCTGCCAGAAGGCTGTGAGCATGAAATGCTCGG
    TAATTTTCTTCCCTACAGTTGAAAAAACAGCTCAGGATGGTGTGGAGAAGTTTGTTGTCTATGCCGAGTC
    AACAATTTGAGCTCATTGGTAATGTCAGATTCTTGTCTCCCACAAAAACCATATGTGCAGATAAAAAATA
    TGACAATGCTGTTTTTGACGTAATGATCTTGCAAACAAATGATATTGTAGAAGATTCATTTTGTGTACAG
    AAATAACAACACTGACAAAATTTCACTCCACATATCCTAAATGTCATATAACTGTTAATATGCTGTTAAC
    TACTATTAGCATATTATCAGTTTTGTACTCAACATGATGGAAAATTGGGCACAACCTCAGCTGCCTTTCT
    TGATGCCACGCTGGCTAGTTAAGAATTACAGCACCTACACCAGTAGTGCTTGCTAGTACCTCTAGCAAGT
    GACAAAGTGTCGTCTTCCTAGAAGGGCAAATAAGAACAGGATTAGGGGAAGGTATTGCAGGAACATGGAA
    ATCTATGCTCCTGACATCTGAAAGCTGCAGCTGGTTACTGCGATCAAACTCCTTGCAAGAGAAATAGGTA
    TCTGCATCTCTCACATGGCACATGCAGGACAGACAAGTTATCAGAAGTAGACAGTCTTTGAAAGACAGGT
    CCTGCCTGATTGAACTTATCTCCTATGACAAGATGACTTGCTTAGTAGATAAGGCAAAGGCTATGGATGT
    TTTTTATCTCAAGCAGCATGCCAAGTGGCCGAGAAAGCCAATGACTCCTGACCTGCATCAGAAATACAGT
    GGCTAGCATGACTGGGAAAATGATTTTTCCCTTGTACATGCAAATAGTAAGACCTTACATTGCATTCAGT
    CTTGGGCCCCTCACTGCAAGAAGGACATTGAATTCCTTGAGGGTGTACAAAGAGCAACAAAGCTGGTGAA
    GGGACTAGAAAACAAAACTTACTAGGAATGGCTGAGGGAACTGAGGTTGTTTGGTCTAGAGAAGAGACTG
    AGAGGAGATCTCACTGGTCTCCACAAGGAGAGCTGCATCAAGGAGGGTGCCAGTCTCTTTTCTCAGGTGC
    TGAGTGAGACTACATAAAGAAATGGTCTCAAGTTGTGCCTGTAGAGATTTAGATTGAACATTAAGAATTT
    CTTTACAGAGAAGGTGCACAAGCACTGAAATGGGCTTCCCAGTGAATGGTGGAGTCTCCTATCCCTGGAA
    GTGTTTAAGTGTGGACATGGCACTAACAGACATGGTTTAGTGGTGGGACTCAATAGGTCAGGCTGATGAT
    TGGACTTGATCTTGAAGGTCTTTTCTAACCTAGATGACTAAGTGATTCTATGAATGATGTATTCCCAGCT
    TGAATGTTATATTAGATTGACTAAATTTTAAAACAACAGGCACCTGCATACCTGTTTAAACTGGGTGCAT
    GTAACATGCTTCTAAGAATGTGGGGATGGGAGTCGTAATAATCTCCTGCAGGCTCATCTACTGTAGCCTG
    TGGTGGAAAACAGAAAGTATGGTCTGTTTCCTTGCCTAATGTAGTTTGGTAAGGTTGTAGATGCTAGGTA
    GAGTTTTAATTTATGCTGATTCTTGGAAGAGTCATTGGATCAAATAGCGTTTCACATTCCTGGAGCAGAA
    TAAATTCTGATATAACAGTTAAAATAATTGGCTGTACTTTGGGCTGCTATGTGCAGCACAGATTACCAAT
    ATACAGCAGAGGGGATGAGATAGAAATTGGCACTGAGTGTCCACCGGGGGTTGCACCGGTCCCTCTTTTC
    AAGTCAGGCTGGGGATTCTGGAAGTTGACTTGATGTTGTGATGGCCAACACCAGACAATGGTGATGGCAA
    AAGCCAAAGGAATTGGTCTTTACATGTTGCCCGACTGCTTACATCTTTCTTCCATTAATTTTATTTAATT
    TTACATCATTTTTTGTTTAATTGTAAAGAAGTCTACAGCCTAAGTATCCTTTCTATTTTATAATATAGTA
    ATTAGTTACATGGGCACAAGAAGTAAGACTGTACTCTGACTAATATATATACAGTAGAAAAATTAGATAT
    TCTTCTTTTGCACATCCTCATATCTGATTTGCTGCACCTTCCTTGCAATGTGTTGTAAATGTAGAATAAT
    TAATTTTATCTTTTTTTTTTTTTTGCCTTCCATTTATAGCACTCAGCAGTACAATAACAAATTGCTTCTT
    GAACATGAATCAGTTCATTTTCTCAAAAGCCCTCAAGGATAATGAAATGGGAATTTTATTTTATAAGTGA
    AAAAAAAAAATCTGAAGAATCTAGTGATTTGGGGTCTGGTATGTGATACCTGGAGATGAATTTTTTTAAG
    AGACTGTTAAGCATTCTCGAGGATTGTCTCTGTCTGTATATAGCTCCCAATCTGTTCTGTTGCTGCTGTG
    ATAACTCAATTATTTTTTGAATTAAGATCTGTAGAGGGCACTTATTTCTTCAAACTGTAACCACCTTCAT
    TGGAGAAACCTCCATCTGAGCTAGCTGACTGTAAGGACTAGAAATATATGTTTGGGGAGCATGAGGCAAG
    TCATCCTAAAGGCAGGCACACAAAGCAACTTAAAACCAAAATTCCATGTAGGAGGGAAATCACAGAATCA
    TCAAGGTTGGGAAAGACCTCCAAGATCATCTAGTCCAACCATCTGAACGATTGATGCTTGTGAAAAATCT
    GGGTTAAGTAACTTGCCCAAATCAAATGGAGATGGTAAGATGAAGTCAAGGTTGGGATTGTTGCTCAGAG
    CTGCTAAACTCAACTGCTCTTGTCATTGAACTTACATTTTTCTTTCTGTTATCTTCTGCTTCCTTTTGTA
    TACATCTTCTTTTTTCAAGTGAAGCGGTTGATACAGTCTCTTTCACAAGATTGGCCTGTTCAGCAAACAG
    GTTCTGGTCAGACCTGCTTCTGGTCATTCTGGTCAGAAATCCTGTGAAAGAAAAAGGAAATTATTATACC
    ATACTATCATTAAAGACTTGGTAACTTTTTAAAGTTATGAATTCACAGGAAGGTAAGGAGAGTAGGATTC
    AGTTTCTGTTTCTGGAGAAGAATATACTTCCGTGATCATAAATCCTCCCACTTCTGTTACAACAAAACTT
    TCCTCCTTCCTTTCACCTCCTCTCTCTTATGTATGCCCTCCATTCAGCCTGTTACTCAAATTCCTCTGTT
    GTTTTGCAAACACCATCACTGATTTCTGTTCCCTGGCTTTCACCACATCATTCCTGCAGGAAGCCTTTTC
    CTGCAGGATACCTTAAGTTCTGCTTGCCTCTGAAGATCTGAGATGGAGTTTGTTCACTGTGAAGAGACTG
    CTGGAGACCAAATAATCATTGCCAAGAAATCTCTTCTGTAATTACGTGAACTAACCACTTGTGACTTTGC
    AAAATTTGTGCAGATTTTCTAGGCTGCCACATAGAACAAATTACTAAAAAGCTTTAGATTACTAAATTAC
    TAAAAGAGCTTTAATTAGATGGTTATAAACATTTTCTTTAGTTCTTTTAGTTCTTTTATTTGCTCATTTG
    TTTTTGGAAATGACTGAATTATGTTTGATAAGACTTTCAGTATAGGAAATTTCAGATCTAACAATTTCAT
    CTTGACCAAGATGAAAGTGACCAAAACAGTTTTCTTGTTTGAAACACAGCCACAGAAGGCCCTAACAAAA
    CTGTAGGCAATATCACCTTTACTTGAATAGAAATAGGACTGTTTCCCCAGTCTATACATTTGAAATTATC
    AGAGTTTAATTTCCTAAGAAAATGACATTTATCCAATCACACATCTGTGCATGTTTTTATATTTTTGCTT
    CCCTCCTCTATCACATTAGTTTTTAATCCAACACCTAATTTCATTGAAGAATTTATATTGGAAGAGGTAT
    CTAAAGATCTTTTCTCCCAGCTTCTCAACTAAAGCAGGGACATTAGTGTAGGTTGCCCCAGATTTGGCTA
    AGTTTTGAATACTTCTAAGGATGGAACTTCCACAACTTCTCTAATCAGCCTCCCTTGTTGTATAACTGCC
    CTCACTGTGACTTTTTCCCCTCATATCACTGTTTTCTCCATTTCTTTTATTGTATATCCCTCGTAACAGT
    TTATATCTCTCTTCTCTATAACCTCTCTATGTAGTGGAAAAAAAAACAAGATCTTCTTTGCCTTCTCTTC
    TCCATGTTGCACAAACCGAAGTCCCTTAGCCTGTGTGTTCAGTCTCCAAACAATTTAGTGCCAGACATTC
    CAGTTTTGCAGTTTCTCTTGTACAGTGGGGTTAAAACTGTACCTAGCACTTCAGATATAGCCTGTATCAT
    GTAGAGCACCACTTCAGAAACATCATGGATTTTTTGATCCCTTCATCTTGACTTTCCATCAGATGCTGGG
    TAGTTTAATCCAGTCTGCAAATGTGAGACTTTTTCCATTTGTTTAAAGACAGCTTCATTCATTTTGATTA
    TCAAGCATCCTTCAGCAGACCCTCACTCTCACATCCTCATGCTGATTCCTCCTTTCATCAGGACTCACAC
    TCCTTGTACACCAGAGTTTATTGCACTAGAGCTTTGCACCCTCTGGTCTTCTCTGCTCATCTTTCCTTGC
    AAGTCTGTACTGAGCAATCGCAGCACACTGGTGCTGCGATGTCCCACCACATCTTCTTAATGCTAACAAG
    GCCATTGTCCTGTGTTTATGTGAACTGACAATTGCTCCCACTTCTTTCACAAGGTGGCACGCATAACTAT
    ACAGGTACTTCAGGTGGACTCTCAACTGCTCTGTTTAAACAAGTGCAGTTTAAAAGCCTTTCTCATCACC
    CTGTTCCATAAATTCCCAGCCTGGAAAAGCTTAAATCAGGCTTAAATCTAAGAAACCAAGTCCATTTATG
    AGACAAATTAAAACCAGACATTGCAACTTCACAGGTCATCTGTACAATATGAAAAACAGTAAATAAATTA
    GTAGCTTTGGAGATCTATTTTCTTGCAGATTACGTTGACTGCTTTCATCAAAAATACAAATATTAATATT
    CAGATAAATGGTACTGTCAAAGTGTCTTCATATTTTTCTGCTGTATGTCTTCAAGGTCTTGCTGTGAATA
    CAAAATTCGCTGTTTTAACAAAAGAAGTTGCTTGTTTCTCCAATCCCAGCACCTGTAAGACTTTAAAGTG
    AATGTAGAAAAAAAGTTATAAAGGAGAAGGAAAATGTGCTAGTAAGTTTTTATCATTTCATCTATAAAAA
    GATAATAAAAAGGGGAATGAGCTAGTTAGCTGACATGATACCTGCTATGAAAACACTGCTTAAAAGAAGT
    GGCATACTGGATTGCTGCTGACCTGACCTTGTTTCTATATGGTTTGCCTCATTTATTCTCTTCTAATTTA
    CCTCGTAAAATAGAGGAGAATGAAAGTAAAATTGCATAGCTGGACTGACACATAAAAAGGAACTATTAAA
    AACAAGTGTCATGCTCTGTTGATGTAATTAGGGGAACCCTTGTAGCCCTTTAGAAACCACAGAACTATGC
    TGATGTTAATGACTTTCATATTAGCGAATTTAGCTGCAACTTCTGTTCTAATTTTCATCAGAAGTAATAA
    AAAATTATCTGATGACAATATATCTCTTCCAGAGTGACTCTCCTCCCTTATATTGCAGTGTTCAGAGATT
    CAGTCTAAAATGGGCAGCTGGTCTCCAGATAAAAGTAATCCTTCTGAAAAGACACATCTGGTATTACTAT
    GAAAGTCCCATGTAAAAGTTCAGCTCAATGGTTGGAGTGCTCTTGACAGACCATCTGAGAGCCACTTTGA
    GCTTTATTGCAGCATTAAATACATACTTTTTTTTCACTTCTAGGTACCGCAATGTATTTCCCGATCCAGA
    TTCTGTTCTTCTGTTCTGAGTGATGTTACAGTTAACAAGATGCTGGGGATGGCACAGCCAACACAAAACT
    CTGCCGGAGCACGGAGAAGGCCGGAGAGTCAGGTATGTGTCATTTAAACAGTCTGACATTTTATGCAATG
    TCTGCAAAGCTCTTAGTGTTACTTACATAGTATAACAAGAAAAACTGTTAATACAGCAAATTTAAAGCTT
    GGAAATATTTCGAGTATTTTAGACAAGACCGCTAGCACTCCACAATTTACTATTGTGTTCTTTTCACACT
    GTTTTCTATTTATTCCATTCTCGGGTCTGGATTTTTACAGACCCGTATTATTTTTTTTCTCCACAGCTAA
    ATTCTAGCTGACATTCTGCAACTTGTGAGTCTGTAACTCCTGACCCCCAAGTGTGTTCAATATAGGAGGA
    TAATTGCAAGTGTTCAGCCTTTCTAGCACTCTTCAGAGCTTCTCAAAACACTTTCTGGATGATTCAGTGT
    CAGTTGTATCTCTAGTAAGCAGCATGACCATGTGGCCTCCTAATAATCCACAAGGTGTTAGCACATGGAA
    CTCAGCATCCCCAAGGCTTGCTACAGCTCCCTGCAGAGAGGCTTGGATACCTGTATACACACTCACCTGG
    CCATGCCCTGCCAACTCTGTCAGCCTCCTCTGGGAGCTGGACTGCTAGGTGGCCGAAATATAGCAGCCTT
    CTCTACACACTGGAGGTTACCAGAAAGAAAACAGTGAGTGCTCCAGCTGTGGACACTCAATTGTGCAAAG
    GCTGGAGCACGTATCTCAGGCAGTCAACGGGCATAGCCCTATCTGACCCCACCTTTCCTACCACTGTGCT
    ATAATGTAGACAGACACATCCCCAAGTAAAGCCAATCTGCCTAAATATGCAGGTTGTGGGGGGAAAATGC
    CACACAGGAATTGTTTGAATGGTCTTCTTGATGATTATAGCAGTGAAGTTGCTGCTTAGGGTGATTCCTT
    TTACAAGAATTTTTGATTCTTTTGCTGTTTATCTCAAAGCTTCTAGATAAAACTCTTCCATTCTAATTAC
    ATCATAGACCTGGCCCCTAGTAGAAACAGGAAGAATACAGCTCACATGATTATGGGGAAAAATTTGGAAA
    TCGAAGTTCACCACTTTAGCTCAACAGGACATGAGGAGGATTAGAGCACATAATCCCAGTTTATGGGACA
    GGTGAAAGATACAGCATAGCTAAGTCATGCATATAGTCATGAGGTTAAAATAGTAAAAATATTTCCATGT
    TTATTGACTGGTATTTATTGTACCTGCAGCTGTGTCATTTCTCATTCATTTGAATCATAGTAAATTTTCC
    TACTGGAACAATAAATTTCATTATTAGCTTCATCTAAACCAAAGAACTTGAAAGCTCAAATTTTAGCATG
    CCTCTTGAAAGTCCCAGTTAAAGGGAAACTTTGGGTGATACTGTTTCTAAAGCAGCTCTGCCAATCTCAA
    ATATTTTTCTTTAGGGATCCAAGGGCCATCTGGTCAGGGCCTCATCAGCCAGGGCCTATCCTACTAACCC
    ATGGAGGGAGCAGGACAAGCCACCAAGGCAGCCAGGACAGACCAGAGTCCCAGTGACAAACTAAGTCCAC
    AGTGAGAAAGTCCAGAATCAGGCTAGAGTTTTGAGTAAGCAGGTCAGTAACAGGTGCAGTGATGGTGATC
    AAGAGGTCTACAATGGTAGCCAGAGAAGACCACAGTAACAGAGAGATTTGGGGTCAAACCAGGTAGTCCA
    TCCACTGGCCAGGGTCACATCAACAGTACAAAAAGCCAGGCACCGGCATGAATCCAAAGAGTCAGCACCC
    AGGGCCCCAGTGCTTACAACCTTTGCTAGAGTCATAGCAATTTGCCAACACGGTATATTTTTCATAAGCT
    GAAAAAGTCACTTGTTCTAAGGCTTGATTCTTGCATTTATCTAATTTCTTACAATTCTGCTATTTACATT
    CTCTTGGGAGACTGTGGTAAAAGACAAACAATCGTGCTCAGGTGATCATAGTACCTTTCTCCTGTTGGAT
    AGATTCAGGAGTACTGTAAGCTAGAATGATGGCACTAAACCTTTTAAAAACTCATCTTGTTACAGTGCTC
    TCAGTTCTAAATCTCCTACCTTCTGGTCTACACTTCTTATCTATTTTCTTATCATATTCCAACTCTTCAC
    ACGAGACTGTAACTTCCTGAGCCACTGACTACATGTTCAGTCTCCTGCCCACTCTCTCCTACAAAAGTGC
    AGTTCCTAAAACTTTGCAGATGGTGCTAAAATACCATATTATACATGACAGTGACATAACAGGTCAGAAG
    CCAGTTACGTGCAGAGGCAGGTTAGTTTCTCTGCAGTGACTGCAGGTGACACATGAGTCGAGTCAAGGTT
    ATTAGCTACTCTAGGCCTGTAAAAAATTTCAAATTAATCATAAGTAAATGTTTTTTAAATTGATGCAGAT
    CATTTCAAATACAAATGCAATCAGTGTTATTTCCCCCACTGCTCTTAAAGAATATACAATGCTGTACTAA
    GTCTGTCTGGGATAGAGTTAACTTTCTCCACAGCAGCCCACAGAAGCTGTGCTCTGCACCTGCAGTTATA
    ACAGCCTTGATATCACACTGATGTTTTAGGCTTCGCTGGCATCCTACCAAGGCTGGATCTTTATGCCCTG
    TGCCCAAAGGCCAGTAGGCTGGATGTGCAAGATGTGCAGAGCAGGCACAACCAAGGCAGCTGGCCTAAGC
    TGGCTAAAGGGATATTCCATAGCATATAACAGTACACTTAGCTATAAAAGTTGGGGAAGGAGAAGAATTA
    TGAAAGTGTTGGTATGCCTAAGCAATCGCTAAACATATTGAGGTCCTGCTCCTGGAGATGTAGCTCAATA
    TCACTTGCTGATGGGAAATAAAGAATAATTATTTTTTCCCTTTGCTTCTGCATGGCATTTGTTTTGGTTT
    TGGTTTTGTTTTATTATTACATTTTTTCCATTTCCATTTAATTAAACTGTATCCCCACCTGCAAGCCTGT
    CTGGTTTTCACTGTTTTTACTCCCCTGTCCTTCTGTGGAGGGAAAGTGAAGAGCAGCATGGTAAAACTTA
    GCTGCCCATTGATTGTTAAAACGCTACAAAAGCCATTCATAGTTCATGTGGATATAGGACACTGTGATTA
    CCACAGTAATCAAGCTTGTTTTGCCCTTTGGACACAATAATGTTGATTCTGTTGTAACTTATCAACTTCA
    TCTCCTTCATTCTTCAAGATAACTTAAGAGCTTTCATGTATTCTGGGAATGATTCTATTTGGTTCCAAAG
    TCAGTGAACATTTTCAAATATAACTGTACCATTGCTCTCTTTTAAAGGTATATGGAAGTTCATTTTTATA
    GCATTTACGCCATTACTTCATCATCACTGAAATTAATCATTTGATGATATTGTTCATATTTATACAAACT
    GATGTAGCCATGTAGGTATAAACAAAGGAAATGATCTTTCCTGATATAATTTGCTATCGAAAAATGGATG
    TAACATATTTCATTAACATGTATGTTTCAGTTGTTAAAATTAAAAGTGCAGATGAGTTAAAATAGTAAAT
    CACAGGGTAACCATCTACTATAAGAAAAAAAGATAAAGGGATTGCACCCCTGGAAGATATAATAGTAGTA
    CTTTTATATAAGGATTTTTTTTGCTTTAGTTCTTCAAATGATCATTAAAGATTTAAACTTGGTGATATTT
    CTGTGGCTGAGCTGTCTTCTCACTTAAAATACTAGCTTAGAAATTACTGCACAAAATGTAAGAGTATTCT
    GTTGTTAGAAGTTTCAAAACAGTCTCTAGAGAACAGCTCAGAGAGGGATCACTCACTGAAGAACAGTCTG
    TTTGTTACAACAACACTCGAAAGAAATAAAGGAACCAAAGTTAACAATCTGATTTCCAGAAATCAGACCA
    AGTTTCCATTATCAAAATAACTTTGAGCAACTAAATCCATCTATTGGCTACTTTACTATGAGTTATGCTA
    GAAGAAAAGGTGCTCTTTAAAAAAGAAGTATTGAATAGCTGGTCTTTGGGAAGTTGACAGGGTTGACAGG
    CAATGTTATTAACCTACAGGGTCACAAGTAATTACTTACCCTGATTGTGTGTAAGGGTGCTTCTGCATGT
    AACTGGACTGTCTTCTGTCCACTGTGGCCTGTAGTTTGTGTGCTTCTGTTTGGAACTGTTGAAGACAGTG
    ACTGTTAAGGAGATTTCTGAGAAAGACTGTAGTCCTAAAATTAAGTGTATTTCATCTGGTGTTGCGCTCC
    ACTGATTCTGACTAGCAGCTACTAGCACAAGCAGAATTTTCTGATCCCTTTTAAGTTTCTATGATAGTTT
    ACCATACAATTTGAAATTACACGTTTATATTAAATCACGTTAGCTGATTCACTATTCCTACTGTAAGGTT
    CTCTGGCTGAATTTGAATTTTGAAATTGTTTAGACATTTCACCAAAATGTACTGTCAGGCATGTTTGCAG
    AGCTGAACATGCATGTAACTTATTTCTGAATTGTAATTACACCAAGATTTACTGTTAAAAAGATCACTGA
    AATGTCAACATTACATAAAATCAATTAACCCACTTATGGAAACTAAATATATCAGCCCCAATCTCATTAT
    TTTTTCTTTTCTATGAAATATGTTACCATACCTGTTTCTTATTCGGTTGAATCTATTTATCTACTGAAGA
    ACTCAGTGCATGCAACCCTTGACTTCTGCTGTTCAGGATACACAGTTCTGTGAAGTCCATGTCAATACCA
    TTGAGAGTGCATACTTTTCTGTTTCCACCACTGCCTCCACTTTTGCTCTTCATCCTCAATACATAGAGCA
    CCATCTTTTGTTAACACAATCAACTTTAGGTCTTTAACTACAAAACAAATGAAATGCGTTTTTATTTAGC
    TAATTCGTGCTCGTAGTTTAATCATGTTTCATATGCAGCATTTTGTTACATCTTTGTAATTATCTACCCA
    TTTCCTCTACTGTACTACAAGACTACCAAGGTTGGTTAGGAGAGGAAAGCCTTCAAAAGAGCTCCAGGGA
    TATTCACTCCCTTGTTTCCCCTCAGAGTTATAAGACAAATACTAACCATGTAATTATTCAGTGCAAGAAA
    TAAAATTTGTCAAAGTTCAAAAAAGAAAGAAATTAGAAGTGAGCATGGAAGTTAGTTTGCAACATCAGTG
    AGCATTTCTGACTTACCACACGCTTTTAATTATATCCTCTTGGGAAGTGACTTAGTTAGGCTATAACAGG
    GTGGACATGCTATGTGACAAACTTCCAAGAAAACCTAGACAGACCCAGGAGAGTGTTGTTCCATTTCATT
    TCTGAACAAGTTGCCTGTTGGAGATACATGTCTAAGTTGCAGCTTTCCTCCAGTGTTAGGGTAGACTGCA
    GTCTTGACTTGTTTTACCTTTACTCCAGGATGTCCAGCCTTCTCCCAACTCAATAGCCTAAGCCTGAATC
    ATGTCTTTTTCTACAAAGGTGAATGAAGATGTGCTCAATCTACAGCCTCTCCAGATCATGAAAGGAACAA
    AGGGAAAAATCATAGAACAAACATTCTAAAGCAGATGAAAGTACAACTTTTATCACAATTTCCAAGTAGA
    AATTGATGTAATGCTGTTATTTTCGGTTTTCTAGATCCTGAGTAAGGGTAAAAAAATCTCTTCCACTGAG
    GAGCATTTCCAATTTCAGAACTGACAAATGTATATAGAAAGATTAATACTCCCTTTCTTACTTGCTCAGT
    TCACCACCCATAAAAAGAAGAAAGGAGCCTATATGAAAAAAAGTGACATGCATAGGACATCGTCAGAAGA
    CAGTACTTAGAAACATAAGAGCATGCCGAAAAATCAGCTGGAACAACTGCAGAAATAGATGGTTCTCTTC
    AAGACAATTTCAGTTAAAACAGCCTAGAAAAGTTTTCCAGACTAAAATTAATGACACTTGCTGACAGCAG
    CTGTGCATATTTCTTCACTCAGGCCACAAGACGATGAATCATTGGCAACCCCACCTCTTTTTACTCTCGT
    CTTTCCATACACATGCCAAGGACAGCAGAGCAAACTGCTGTCCTTACAAGTAGCATAGACTTACTAAAAC
    CTGTGGCCTCAGTACTTGCAGGCAGGCTCACTATATTGGCGCTGCTGCATTTGGTGAAGTTAGGACCAAA
    TTCATTGCAAGTGAAACAAGCACGGCTTTGGAAAAACTGCTGAAGCTTCCTGCTATTTTTTTCCATTCAT
    TTTGAACCCGTGTGCCTGGCTTTTCTCACTTATGTTTAGCTTCTGCAGACCCAAAGAGGACAAGCAAAAG
    CAGCTAGGAAAGTCAGAAAAATCTACATCTGATATATCACATCAGAAATGGTTACAAGGATCATTGTTTT
    TTTTTTTTTTTTTTTTCACCACAAAACCCTCAAAATCATTAATATCCTGCTGAGATTCTGATATGCAGTA
    TACTGATATTGAATTAAATTGTTGAAGAAAATTTACCCAGACCCAAAACAAGGTAGAATACAGCTCAATA
    GATCTTATAGCTCTATAACACCTACAGATACATTTAGGTAAATTTAAGATTTTACCGAATCAGTCCAATG
    TTCATTTTCTGCAGAAGTCGAAACATAAGTTTATCACAATGTACTCCTTTGTTCAATTTTTATAGTAAAA
    TTTGAAGAAAATGATGTGAAAATATCTCCCTGATCTAGGGAGAAATTTTTACTGAAAACTTTATCTCAGA
    AACACCTCATCCTTTTCCAGTGTAAAATTTTTCAAGATGTGGTGAAGCATTTAGGGTCTAGTACTCTTGA
    ATGATGAGACAGACAGAGGAAGACTCTGGCCTAAGAGCGTTGTTTTATGAGGGGGTCAGGCTTATTTCTC
    TCAACAGAAACATAGTGTATACATACACAGTGGGTGAAGAGTGATGTACGTGCTGGAGCTGACAAAGATG
    GAGCTTTGTTATGGTTATCTGTTTAGCTGACCAGAACACAAAGTGTAGCTATCCTTTCTAACATTCAAAT
    TTAACTTCAGCTTTGAAAAAGCAATCTACAGCAGACAGAAGTCCTGAGGATATAAACACCAGACAGTTTT
    ACTCATTTTCTTACCCCCTTTCTTCTACTATTCTGTATTCAGAAAACACACGACTTGCTTATTGCGCTCA
    AAAAACTCTATGCTAGTGACGATTGTTATCTCTGCTGGTGTTATCTAACAGTAACTGAATGCATTATAAA
    AATATAGTGATACAAAAGAAACATCTAGAGCATGTACATTTACTGATACAGTTATTCTTCAAGTAGCTAT
    TCAACTTTTTTTTCCATGGGAATATTTGCAAAACTTTTCCAGTGGTCTACAACAATCTACTTTTAAAGCA
    GTTCCTTCTTTCTTTCTTTTTTTCAAGCTTTTCTATTACAGGACAAAAAATCTCACTCATCTCCTGCCTT
    TGTGTAACTGAAAACACCTCTCAGATTCATGAGATTTTATGGAAGCCTGTAGATTATTTTGCATAATTTA
    AATGGCAAATGAATATTTCAGCTCTCATTTTAAACTGTGTGTGATTACAAGACAAATAGGTCACAGTGAG
    AACGAAGTGGTTTTCTAGTAGACTTCATCCAGTTAAAAACAAATGACTCGGCAATAATGCAAATTTATGC
    ACTGTGCATACGTGACGATTTTCAACAAGAAACTGAGTGACATACTGCACTGAATGTTGACTAATGAATA
    ACTGTTGAGGAGGTCAACTCAAGTTCTGCACTACACTTAGTAAAAGTGAGTTTTCAACACTAACATGACA
    CAACAAGATGGAGGACTGGTAGCTATCCTATGTTCTTTTTAGGATCTTGTGTTGGGGACCTAAAGGCCCC
    TGAATGAAGAATGATCCTGGGATGAAACAAGTATTCTGACAGTTTTAAGGGAAGTGGCTACAGCCACAAA
    TGTTTTGTTTTGTAGAGAGAACTGACCTTGGTAGTTTATCCTGTTTCTGCAAAGACTTGCTTTTCAAGCA
    GGTGTTCCACTTGGGCTCTGTATCGTGCATGGTATGGCGTGCAAGTGGAAAAAAACCCTGCAGACACTGG
    GGAGAAAAAAAGGAGGAGAGAGTCTGCAGTGGGTGAGAGAGGAAGAAGTGCATCTTGAAGCAGGGGATGC
    CCTGCTGCCTTCACCTATCAAATCCACTGCCAGAATGTTCCTCCTCTCCCCTTTTCAGCAATTTGCTGTT
    TCTCAAGGGTCTCTAAGTAATAGTGCACTGGCTTAGGGAGTTTCTGTTTGCCACTTATTGGGATTATCTA
    CAATGAATGCCTGCGTGTATATGAGTAAGCTGAATAAAACTCATAACCCTCTGTGCTGCTCTGTTTGTGC
    ATAGTTTGCTTGCCTCTGGTCCTGAGGCATCCTGACTCTCAGATCCAACTGTACCTTGAAACAGATTTGA
    AGGCTTTTACCAGAAGCTACACTAACAGTTCAGTGCTTATACTATACCAAAAGTATGGTAGCATCCTAGA
    ACTAAGACAGAATGATTTATCTCAAAGCAATTTATGTCACCCATTTTATCCTGACTTAAATATCGAGTTA
    CAACAAAAACTTTCATTTAAATCAGGGTTCTTAATTTTTATTTCTATTTACATACCTCAGTTACTTTCTT
    AAGAAAAGGTCCACACTATCACTAAAATAAATTTTCAAATCAAAGAAATCTCCATATTAAACATACTAAG
    AACATATATTTCTTAAGCAGTTCTGTAAGTTATACACTCAGAATCTTAACTGTTATCCTAGAAGCTTATG
    AATGATGATTTTTTTTGTTTGTTGTTTTGTTTCTTATTTTGCTTAAAACTTCTGTCAGTATCTGTTCTGA
    AGAAACGAGTACATAAATAACACACTTTAAAACAATTTGAATAATGTCTTGCATGAGTATCAAAAGTAAT
    TCTGAAACAGAAGAAAAAAATACCACTCTCACAGTAGTAGATTATTCTTTTTGCTCAGTATCCCTCAGAG
    TTTCTGAAAGACATGCAAGTACATTTAGAAAAATCAGCCTACCTATTTGAGTAGGATAAAAACCTCAATC
    TTACTGAATTCAATGGGATATAGATATTATCACCGCTATAGCTGACCATAACTTCAGGTCTATGGGATGT
    GACTTTTCTCTGGATCAGGGAGAATTCTGCAGGTACTTGTCTTGGTGACCAAAATAAGTACAGCACATTT
    TCCCAGGTATGTAGAATTATGCCATTTTTTACTCACAGTTTACAACTAAGAGAGAAGAAACTTTGTTTTC
    TCCTTTCCTAATAGTTTCTTCAGCTTTCACATGGCTATTTCAAATGATGAAAATGTTCTCACAACACTTT
    ATGAACTGAAGCAAAAATAAATTAGACTGAAACCACAAAGAAAAAGAATATTTGTTTTTGGTTAGAGTAA
    ATATGAGCATTTGTTGCACTGTAATGGCTGAAAATAATATGAATGTTTACTCAAAGTAGTGACATTATGA
    CTTTCAGAAAGCTTAAGCTGCCCTTAAAAAAAAAAGATATGTTCCCTTAGATTATACATGCTTATATAAA
    GCAGTACTCTTCAGAAAACTACAATATGAAGAAGCTTAATTAAAGTAACATTTTACATTCTTAAATTACT
    TAAAATCTTCTATTATGTTTAGAACTTAACACTGCCTTACAAAATTTGAAAAGTAAATTAAAAAATATTT
    AAGGATAATGAACTGCTAGTTAAAATTCTAAAAATCCATTACAAAGAAAATATTTATCTATACTGATAAA
    CAACAGGGAAGAAGTGTTCGAGAAGTTATAAAGATGAAAATACTAGCCTTAAATCTGATACTTAAATCTG
    CATACTTTGTTGGAGATTAAAGAGTCTATCGGGCAAATATAAGTACACTCTTCTCTTGGTATTCACAACT
    GGCTGTAGCTGGAGAAAGTAGGTCTAGAAGCCCTCTCTACAAATCCAGAGCCAGCTTTGCTTTTCCTAAA
    TCCTGTGCTTCTCTAATTCTTATCATGTTCTTATCATACTTATCTAATCCTTATCATCTAATTCTTATCC
    CTACTTTGTAAGATAAGTACTGCCTGGACATTAGGAGGGACTAATGAAGAGTACTGTCTGTGCCACGCTT
    CTTAAAACAGGATTTCCTGCAGCCCTCTGGGTGTACAGAATCTGTACAAGGATCTTTAATACAGCACAGA
    CCCATGTTTTCAATTAGTTGACTCCTGCACGCCTCCTACTCTAATGCAAAACTGTTACTGGCTGTACAGA
    CAGCCAATAACAAAGAACAGTAAGACCAGTCAGGCTCTGAAAGCAAAAGATAGGAAATCCAGTGGAGGGA
    AAAATACTGGAGATAGCAACTTGCAGGCACAGTTTCTAAGTGTAAAATAAGTAACAGTGTTTAATCTGAC
    CTAATCGATTTGCAAGAAAGATTGTGAAATGGCACGTAGCAAGAGTAGAAGGAATGGGCAGTTTGCTTTA
    GAAAAATCTAACAGACTTTGGAAAAACACAAGAAAGGAAGTTCTCAACCATTCTTTCTTCATAAGAATAA
    TAAACCAGATGTTCTGCCATTTGTAAACAGCTATTAACTTCACATCCTAGATCTTCATGATATTAATTTA
    TCTGCTCATACAAGGGATGTTTATAAGATATTTACTGTTTCAGTTTTTATAATAGTATGCATACATATTA
    AGAGATATGAGTGAATTCATTTGAGTGATTTTCTTCAAAAATGAAACCTAGTTAGTTGTTCTTACAAAGA
    CAACAAAGTACATTAGCCTGCGACATCATGCTTCTCTTCAGGACAAATAAATATCGTTCTTTGAAGGTAA
    GCATGTAGTAAGCATGCAGATCAAACACTGTATTAGCACCTGCTTAGAATGGCATAGAACTCATTTCTAT
    CTTTACTATCCAAAAGTAATGGAAAATAGCAGTTTGGAAAGAAGACTATGGGAAAATATTTTCTTCAACT
    TCTCCTCTTATCTCCTCCCACAAGGCAGATATAGCACATTTACTAGACAGTTACCTATGGCTGAATTGGC
    CATTTATTTCAGTGGAAACTGCTGAAGGCAGTTCATTTTTAAAGTAAGACAAATTATTACTTTTTGATTG
    ATGTAGATGTGAAAACATGCAAGAAATATTTCAAATTTTCAAGCAGTATTGATTTGTTTGGCAGACTGCA
    CTATTTTCTAAAATGTTTATTTTACTTCTCAAGAGTAATGATGGCAGTAAGCTGTTTGGTGTGGTAACAT
    GCCTGAGGGACAGGATGCCATCTAGAGAGACCTAGACAGACGCACGCAGTGAGCCCAGGTGAACCCCACT
    TGATTCAACAAATCCAAGTGCAAGATTTTGCACCTGGTTCATGGTAACCCCCACTATCCATACAAGCTGG
    AGGATGAAATGATAGAGCACAGCCCTGTTGAAAAGGACTTTTGGGGTACTGTTGAATGGCAAGCTAGACA
    CGAGCCAGAAATGTGCTCTCATAGCCCAGAAAACCAACTGTATCCTGGGCTGCACCAAAAGAAGCGTGGC
    CAGCAGGTCAATATATTTTGTTATTTCTATGATTCCTGATACTGATTTATTCTGCTTACTGATCTGTACT
    TCTCAGCAAAATATTTTGTCAAATTCTCAGCAGCTCTGGAAATGGAAATAATTTTACTGGTTTCAATAGA
    TAATGGACACACATTAAAATTTCATTCTGCTCCTTAAAAATTAAAAGTGTAGGAAAATAGTAAAATATTT
    CCAGCTTCCAGATCCTTCTTGCTTATCTCGAGAATCCAGTAAATTGTAATAATTGGTATAAGATAGGGTC
    ATAGGTTATAACTTTTTTTTTTTTTAATTTAAAAATGTCTCAAAATACTGCCTCACTTCACACTTCTGAT
    ACTGCAATTGTTACATTTAATCTATCTATTCCAGGTATATTGCAGATCTTCATTAATATGTGATATAATT
    CGCTGTCCCAGTGCTAATACTATGCTAAATCTGAGATACTGTCTAGCAGCTGCTCCTGTGGTAACTATTT
    TACAAACTTAGGGTTTTCATCTTCTCCCCATCACTATAACAGACCTTACACTTTTACTTTTAAAGTTCCT
    TTCTTTGACACTGTTTTTGATTTTAAAAACCTACCCCCTAATGCACAAAATCTGTAATTCTATTTTAGTT
    CCCTGTTGAATATTTGTTGTCATGGAATGAAAATGTAACAAAAATATTTACAGGGACTGACTAGAAGCAT
    ATATAGATCAGTACATATTTTGCTATACAAACTTCAGCACTGACTAGATATGCTGGTCCTTTTGCTATTC
    TTGTTGTTTTGTTCATGTCCTTTACAATCTCTTGTGATTCAAGAGCTTACTTATACAGGAGAGTATGTTC
    TGAAAAACATTTTCACTGTTTTCTGCATATTGCATCCTGAAGGGGTCTTGAGTTACACTGAGAAATTAGT
    GTAAGTAGATTTAAAAGGAAAGCTCTTGATGTAAATAGTAATATTCAACTAGAAAAATCTTGCCCTAAAG
    ACTTCTTTTGGGTTTCACTGCTGCTGTGACTGCAAGGTTCTTTAGAAAGGTATAAAATCATTCTCCGCAC
    CAAGGACTAACTTCTTCTTAGGCCAACAGCTAAGTATAGGATCCATCTTCATAAATGATACAAGCCCAGG
    CTTCAAGCATGTTTTGCAAAAGAAAGGTCAAAGGAAAGATTTAACTTCTTTCATTTCAAATTCTAATGTT
    TAAGATATTGAATGGAATAATAATGATTCTGTGACCTTTTGGCAATGTTTTCAAGCAGGCATTGCAAACT
    TTACTTTCTTGTTTCTTCACCTGGCATACAGGAGAAGGAAATCTTACTGGATGACTATCAAAAGCAAATG
    AACAAGTATTCCTGAAAACCAAGAACATATCAGTGCATAAGTGGCAGCTAAGCAACCACACGGTTGCTTG
    CTTACCATTCCCACAGTCAGATGTACAGAGGAGAAAACTGAAAGGACAGAAGTGAGGAAAACTCATAAGC
    TGAGATAAAAACAGCCTAATAAATGAAAGTGAAGAATAACAGAAAGCCAAAACACAAGTGATGCAGAAGT
    AATTACTTGTCACCTCCCACCAGTGGATCAATGTCCAGCCAGTTTCCAAGCAACGGCTGCTCTTTAAAAA
    ATTCACCCTCTTATCCCCACCTGTGCATTTACCTACAGATTTTAGAACTTGTGATATTATATGGAATTGA
    ATATGCCTTTGGGACTGCTGTCCCAGCTATGTCCCCTCTCAGCCTCTTGAAAACCCCTAGTTTATTTGCT
    GGCAGGGAGGGAGAGTGAGAAACAGAGAAGGCCTTAACAGTGTAAAAAATTGTTCAGCAATGGCTAAAAT
    ATTGGTGTATAATCAGCATTATTTTGGTCACAAATTTACAACTCAGCGCCGTTCAAGTAACTATGAAAAC
    ACTTAAATCCATCCCAAGCAGACTCAGTACAATAGTTAAGGTATATGGAATGTGAGAGGAGAATACTGCT
    GTCAATCTATTTATATCTCTGAGAGATCCCTGTGAAGGAAAGAGCTGCTGTAGACTGAGGATCAGTATTG
    AAATTAAATGTTCAAATAAAGAACTTGTAGGTTCAGGATCTAAATTCTCTAAGAATAAAAATACTCACTT
    CTTCCACAAAAGCAACATTGTGAGTTCCATAGTTGTACAAATATGATAAAAGCTAATGTTAGTATCTTTT
    CTGTGCTGGTATTAGGTAACAAGAACCTGTATTCACTTGTAGTTGCCAAAGGTAATTGACAAAATGTATT
    CAATTCTCAAGAAGATAAAATCACAGAAGGAGCAGGAACTTGTATTTTTCCATCTTGAGCTTTTCTCCTG
    AAAAACACCTGGGTACACCCACTTCAGATCACTGAATGTGAAGATCACCTGGAAAATCCCCATAGGGCTA
    ATATAAAGAAATCTCATTTGGGAGGAAAGTAGGCAAGGAGAAAGGACAGCATTATCTTGTACTACAGTGA
    TACTGCTTCTGTGCTCAGATTCTGAAGGGGGTTCTGCTTTTGACAGAGACCTGGCTGAGAGTGCAAATGT
    TTAGGTCCCAGAAGCCTGATATTAATATGGTAGAGGATGTTTGACTTAGCAGGAGAATCTTACTTCAGCA
    GGGTAAAAAAATGTCTTCCCTTCCTGCACATTTTCTCAATTGAATGATAGAAAATTTTATAGTAATAAAC
    TATGGACACAAACAATTAAGAATACTGGACCACTGTAGATAAAACTAACTTACACAGCAACTCAGTTTTT
    CTAATTATAATTATCACATTTCAAGGATTCACTGAGAAATTTACAAACAGCACTTAATAAAGGAATTCAC
    ATATACGGTAGGTAAGTGAAGTCATATAGTTTTAGCTTTCCGTAATTTCCTTTGCATGTAATTTAAATAT
    TGTATAGAACTATGAATATTTTCTTTTGACTATGTTTTTGTTTTGTTTGTTTTCTTTTGTTTTGGTGACA
    GCCAAAATGGCAAAATCAGCAGCTGCTTCTGTCTTATTCTGTCTTGCAAACTTTTGTCATCTGCTTAAGT
    TTCTTTCTTTAAAAGAGAGAATAGTTCTACTGTGGCTTACATTTTACTCAATGATAAGTGCTTCATTGCA
    ACTTGGTGATGAAAAAATTAATTTATTTTTTCAAAAGTGACAGACCATTTCTGTCTAATATAACTCTCAG
    TTGCATCTTACATAAAGAAATAAATAAAAAATATTCACTTACAAAGTCTTTAATCCCTACTCTGGTGTTG
    CAGGTTATCAGGTTATAACCTACAGGGGGGGGGGGGGGAATTATTGGAATATAAACTGCTTCATTTTCTT
    TTCAAAGTCCAAAGTTCAACTGTGCATAAAACAAGGGCAAGTATCAAAGGCATAATAAAGTTGATTAATG
    ATTAAACAGAGTAAGAAATGAAAACCTAATGCTAACATAGGGAAGGTTTTAAATAAACAAAGTGTGTTCA
    AAGCAAAAGAGTAGTTTGTCAAACTAAGTAAGTGAGATAGCATTCTTAAGTTGCTGAATAGTAGTTCACA
    TGAAATATTTAAGACATACAGGTAGAAAATTGCCCAGAATTGTAGAAATGATGTCTTAGGTGATCTACTG
    GACCTTAAGAACCTCTTTCTTTATAAACAAATGAATTTCCCTAAATTTTACAATTAATAAAAGGTTTCTC
    ACCTAAAAACTAAGTTTATTTTTCAAGTAAGGAACAATTATTCCCTTACTATTTGATGGTTGCCTACTGT
    TGAAGAACAGCAAAGATTAAGACAACTACATTAATCATTAAGAACACAGCGTTCCGCTGTCATCACAGTG
    AGCCCTAATGTATTAATTATGAACCAAAAACTGAAAAATGCTTCAAGATCCAATATAATTTTTGGTCTGA
    CATCTTCATTAACAGCCTCCATTGACAAAAACTAGCTTGTAAAATGATCAGAACGTTTACCTATTGCAAA
    ATGTTTATGATACATTTTAACTAATTTTGTTAAAATGTTTTTAAACACAAGAATGTTTTTTTTCAGCTGT
    AGACAAGAAATAAGATTTAAATTTCTTAGTACATATCTAGAAATCTTCTAGAAGATTATTTCTGAATTTC
    ATTTAAATTAATACATTAAAAAATATATTTAAAAAAACAGCAAAATAAGATATTGTTAAGAACTGCCAAA
    TCAAGTCAAAATAAATAGAATACACATTAAAAAAAAAAAAAAGAGTTGCTTTGCTTTGTTATTTTGTTAT
    TTTTTACAGAAAACAACAAATATCAGATCAAACAATGTGGAAAGGTTGTGGCCTTTCTATTGTATTCTAA
    CAAAATTACTCAAGTGTTTTGACAACAGCTAAGTTGTACATATTTCATTATGAGTGCTGTTTAAAGGTGT
    ATTTATTGTATTAGTACTTAACATTTTGGTTTGAATAGTCATATATTTTGGATTTCCATTTGTTATGGAA
    ATAGTACAGGTTCAGCTATGTTTTTAGATATACTTTGGTTATAGGTAACTGAAATAGTTCCAAAGATGGA
    TGAGATATTATTGATCTGGCCATAATTTCATTAGGTATGAAACTGAATTTACCTTTCACTTACGTACTTC
    TTACATAACAGATTTTGGACACAAAAGTAATACAAGAATCTGGCACCATTTTTTGTTATTGAGTGTGGAA
    ATGTATGTGATGGTGAGGTTACTATATTATCATCTCAGCAAAATCTTTTGGTTTTGGAAGCAAGACAATT
    GAAATATATTGAGAGTATTTTCTGTTTAAAACAGTAATAAATACTAGTTACAAGTACTTTTCAGAGCTCC
    CCTGAGGCACACACTAGTATTGCTCTCCTAGCTTTGCCAGTAGATGCTTTAATCACAGTTAATCAGCTTG
    CAGCAAGTTAGCAGCAACCTTACCAATAAAGTATGGATAGACCTTTCACTCTAATTTTTTTTGCTACCAC
    ACGGTGCTATCTTTTTTTTCTATTATGTTCTCTGAACAATTTTTAAACATGCACTTGTAAATTAGTGTGG
    ATATAAACCACAATGAAAGAAACACAGTTTGATAAGAAATTAAACACTGGACCAAAATCGCAGTTGCAGA
    TAATTAACCTACCTCTGTGAAGAAGCCGTATATGAGCTCAAATTAGTTTGATTATCAGAAATTATCACAA
    ATCAAAAGTTTGTGATTCTGGAACAAAAGTTCCCAGGTTGTGCACAATAGAACAGTTAGTGTACAGCTCA
    TACCTTCTCTTTTCCAGTTGTCAAACTCCAATGAAAGAATTGACAGACTTGAAAGGTCGGCCCGGGTGAA
    CCTAATGAGGTTCAACACGGCAAAGTGCAGGGTTTTGCACTTGGGTTGGAGGAACCCCAGGCATCTCTAC
    AGACTGGAAGGAGCAGTCCTTGAGAGCAGCTCTGCAAAAAAGGACCTGGGGGTCCTGATGGATGACAAAC
    TTAACATGAGCCAGCAGTGTGCTCTTGCAGCTCGGAAAGCAAATGGTATCCTGGGCTCCATCATGAGAGG
    GGTGGCCAGCAGGGACAGGGAGGTGATTGTCCCTGTCTACTCTGCTCTTGTGAGGCCCCATCTGGAGTAC
    TGTGTCCAGGTATGGAGCCCCCAGTACAAGAAAGACAGAGAGCTGTTGGAGAGGGTCCAGAGAAGGGCTA
    TGAAGATGATCAGCAGGCTGGAGTACCTCCCCTACGAGGACAGGCTGAGGGAGCTGGACTTATTCAGCCT
    GGAGAAGACAAGGCTGCGGGGTGACCTCATTGCAGCCTTTCAGTACCTGAAGGGAGCCTATAAACAGGAA
    GGGAGTAAACTCTCTGAAAGGGTAGATAACAGCAGGACAAGGGGGAACGGTTTTAAGTTGAAAGAGGGAA
    GATTTAGGTTGGATGTTAGGGGGAAGTTCTTTACCAGGAGAGCGGCGAGGTGCTGGAACGGGCTGCCCAG
    AGAGGTTGTGGATGCCCCATCCCTGGAGGTGTTCAAGGCCAGGCTGGATGAGGCCCTGGGCAACCCGGTC
    TAGTAAATGGGGAGGTTGGTGGCCCTTCCCGGCAGGGGGGTTGGAGATTCATGATCCTTGAGGTCCCTTC
    CAACCCAGGCCATTCTGTGATCTGTGAATTCTTAAATGCTTCAATCACTTCCCAGTATTAGATGCACATA
    TAGTAGGTATAACACTATAAATATATACTGTATCTAACAGTTTAAGTATCTATACATGTAAATATAGCAC
    TGGGCATATGTATATCTAGCACTTCACATATACACAGTCATGATATTGTAGATCATGTTACAACCGTAGG
    TAATTTATAAGATTACGATGGCAAATAGGTAGCCAGGGGAAAAATCTGTAGGATAGAAAATGGAACAAAA
    GATCTTTAATACTGTTCTTTCATTAAGGTAGCCTGCAGTGTGAGCAGATAGGAAAAGAGGATGAGTTTGT
    AATATTACGTTGTCCGATTTTCTGCTGTTTCAGAAAATGACTACAAGCTACAGATCTTTTGGTCCTTCAT
    TATAAACACAATAGGTAGCCTTGCCTTGATTGGATATCTTGTCAAATTGATCAAGTCAGTACTAAAAAAA
    AAAAAATCATATGAAATAAAATTATGACACACTATCTTCTTGGTTGTATCTTTCAGAAAACACATGTGAA
    AAGTATTTGTCTCCAGTACCAACTGTATCTACTTTTGAACAGCCATTTCTTTTGCCTTTTAAAGAATAAG
    ACTGGACTAACCATCTTCTTCCTATGGTAACTACAAAGTTAATATTAATGAGACAGTAAATACAAATTAT
    CTATTTTTTACTATTACAGTTGTTATTTGTAATGGCTTCCCATTGCCTTAGGAAGTGGATCCTCTCCTGC
    CTTGTTATGTAGTCCTACAATGCTCCTCAGGCCATGGTCCCTTGCTTTATTCTTTCTTTCTCTGAGCAGG
    CTCCATCCAGTTAATGTGTCTCAGCCTTTATCTCCATGATAATTCTCAAGTTGTTTGAACTGTTGCATTT
    GAAGATTTCCATATGCCTCTGCAGTGAAAAAAACAATGTGAACATGTTTAAATATGTGTGCTGGTTTATG
    TATATTAGATGTTTCCTTCTGCTCTGACTCCACTTTCCTGTCTTAGAAAACTGACCCTGACTCTAGCGCC
    AGCATCCCCTACTTGTTCTCTCCTTGTCAAATCTCTTTACTAAGGTCTAATGTTTCTGCTCTGTCTTCCT
    GGAAGAAAAAATCAGGGGTAAGTGTCCTCTGATTCTTGTTATAATACTTCTTTTATTTTTCTTTCCCAAA
    AATCTTGTTATCATTCAGCCTTTGTTTAAGGCCTAAATGGTGAACAGCTGCTTGTTTTATACTAACTTCT
    CAAATCAATTTCTTGTCTTCCTTTCATTGCCTTACATTACTTATAATACAGAAGTACTGAAAGGGATTGA
    AATGAAAGGTCAAAATGGGGACACGCTAAAACCATGGTTCACAGTGCAATAATCTTCCAGAGGAGAAAGA
    AATCTACCTCCTACCCTTTAGTGGTTCACTCCATGCAAAATATTATCCAGGGCAGGAAGAATCTTTTCTG
    TACACAAAAAATTACCTGTAAAATGACATACAATATTTCTACAGGGATAAAGACAGAAATTTCATAGTAG
    CAGGAGGAAAAATAATTCAGTATAAGAGAAATATACAAGAATGAAAATATACAAGAACAAAATTTGTTAT
    TTTGTTGTGATACTTGGAAAGAATTGTAGGTAATTTACAATAAATAATTGATTCTCTTGCATTACGTCTT
    TTAAAATAAGCTTTAAAACAAAACAAACAAACAAAAAAAAACCAACAACCTGAAAAACAACCTCATCTGT
    TTAAACAGTGTGGCTCTGTGATTTTACAAGTTGTCAAATGTACTTGCTACACACATTAACACACATATAC
    ATATCTTTAGTATCTGAATAATCGGTGATTCTTTTTTTCAGCATAAATAATGTGTGTACCTACTATTTAG
    CCTAGTAGTCACTGTTTTTCTTCTAGTGCTTATGTACCAAAGACAGAAGCAAATCACTGTAAGTGGTCAG
    ACGTTCTGAAAGATTTGGAGCTGATCAAGACATCTGAAGTAAGTTCAAAATAGTCACTATTTTATACAAT
    CATAGGAGCAGACATAACTACGTGTTTAGCACAGTACTCAGCTAAGAGAGTCAGTGACCAGGAGTATGAA
    ACAGGATATTGTCTGTGTAGTCATTTAGGGAATAAAAGCTAAAAGGAACTGGAGAGCTCTATTTTATAAT
    AGCTCTATTTTATGTTTTTTCAGAATTTCTTTAACTGGATAAAGCAAGAAGAAACTTTTCCTAAAGAAAG
    GGGCAGAGGGCATGGGAGCCCATCTTGCAGGTTACTAGGTGACTTTCAGATCACTGTCTCACTGTGTTCC
    AGTGCCTGGATTAATTGAACTGCTGAACTTGAATCCATGGCTCTAGTGTTTACTTCATTATTTCTAAGTC
    TGTTCATAATTACAACTCTTGTTTCCTTTTAGGACATTGATGTCAGTTTATATACTGCAAACACATACGA
    GGATGTAAGTATAGTTAAAATTTGGCTCAAACTGGTCTAGTACAGTAACTTCATTTCTTTACTAGCAACT
    TTTTCCAAAGGTAGACTTGCTCTAACTTGAGAAAAGCTTCAGAAACCAAATCATTTGCCTTGGAAGGCAG
    AGTTCTGCAAGTTAAATTACTTATGATGAATTATGTAAGCTGGTACTAAATAATTTTACTGAAGTAGCTG
    CTATTAAAATTACTCAACTAAAAGGGATGATCTAAAATGATTTTATCAAAGCAAACACTGAAAAATAATG
    TTGATACTCATTTGTAATTGGAGAAAGTGAAGGAGTGACAGGGAAAATATCTACTAAGATTATTATTTAA
    CACCATGCACTTGAATTCTATAATAAGAAAATGCTTGAGAAGCGCAATATGGAAAGGAACTGTCAGCATC
    TGCCAATACAATTCTCTGTTTTTACAGCCTAGAAACAAATAATATGTAATATCAAGAATTTAGCCTTATA
    ACTGATAGAGATTATGATTTATCCTACAAGCAATAAATTATGTTAATTTTTAATATAATTGTTAACTAAG
    TCATGGTTTCCATAAACTCATTCCTGAAGAGAATTTTTCATAATTTACTGTGGAATTCAGTCTTCACTCC
    ATGCAATCCTCTAAGGACATGAATCCAACCAATAACCTACTCCTAGCAGTTACTTTTAGTATAGCCCTGG
    TGCAACATGAGCTGGATTCATTGCTGTGGTGATGTTGGCAGTAGCCTGCTCCTGAGACAGCCTCCTCCCG
    ACAGCATAAACATTTACACAATGACTGTGCCGAATACACACAATACATTGACTCCTGTACGCAGAGTTAA
    TGAGATTTCCTAGAAATAATGGACTTATTGTATCTGTGCAAAATAGTCCCAGTGTGCATGCAGAATACAG
    TAACGTTGATGCATTCAGTGGACCTAGCAAGCCTGAGAAAGCAGACTCTAATGTGTCTGTGCAGTTAGCC
    CTGTACACAATAGAAAAAAAAGCTGCACAGCATACATGTCCATACTCACATACCCATTCTCTTGACTGAA
    ATGAGCAACTGAAATTAATACAGTATAAAGGCTAATTTATTAGCTGGTAATGTCAGGAAGATTTTCTTAA
    ATTGGAAAGGCTCGATGTGAAAATCAGGCAACCTGGGGCTTGTTCTTGGTTTTATTGTTGACTTGGTGAA
    AAAATGGTACCTCTGTGTTGCTGTTGTTGGTTTTTTTTAATTATTAAAATATGGGTAATATCTACTTTCT
    TTTTCTCCTCCACTCTCCATTATTCTGAATAATGAACTCTGAATATAAGTGCTAGAATTACTAAGAACAC
    TAATTTAATTCCATTAGTGTTAATTCTTTCCCATATTCCTATCCTAATTATTATTCCCATGTTCTTTGTC
    AAGACATAGTGTTCTGCTTTGTCATAGGAAATTGGCTGGCCTATGTGTCATATATTCGCTCTTAGTATAT
    TTTTGCAGATACTTAAAAGTATTCGAATAGTAAGAACAGATACTAAGTAAATAAAAATCACCACTGTCTG
    GTAAATTATATCCCACACTCACTTATCCCAATTTAATCTTAAAACTGCTATAACTTCCTTATATATTTTT
    TTTCCAGATAGAATGCCAGGAACCTGTAATGAGATGTTTTTTTTTAGAGATGAATGTGATTCTTCACGAA
    TGTGGTATCAAAAAATGTAGTAGGAAGCATGATGTACGGAACATATTGAAAAATGGAAATGCAAGATTTG
    CAACTTACCAGGTAAGTAAAACCAAAAGTCTGTGGATAAAATAGAAACGAGAGGTGTTTCTTCAGAATCA
    GAAATTCTGTTTCTCATACATCTGGAAGAGGCAAGATGGTACATATGAAAGCAAAAGGGAATCAACCAGT
    AACCCATGCACATAATACTGAGAAAGTTACACGTATAAAAAGGAAAGAGCAGTATTCAGTGATTTTAGAA
    AAACACTCCCAGGACTCATATCAAAGAAAATAGTTGTGACTGGGCACACATGCAGACATTAATGTTTGAA
    TGTGCATATATAAATAATAGTTTGTAACTTCAGTATCTAAACTCAGGTACGTTTAGTCACAAATAGAGAA
    GAGTCCCAATTTTCAAAGGGATAGGTGACTTAAACCTCTCACTGAAGCACTGTATACTTGAAAGATGATC
    CTATTCAGAAAACAAGCCAGGAACAAAACTTGAATACCTTGGAAGATTCCAGCAGTGCTTTCTGTAGCAA
    TCGACTGCATTGGAATTACTGACAAAAACAGAATAAAAAGGGTTAGCTCTCTATCAGATCAAATAGACAA
    AGTATCTTGCTTTACTATTGCATTTTCTTTTTCAGTTGAATTCCACAACATCAAAAAAATGCAAAGAATG
    TGAAGAGTATGAAGAAAAAAATTTTACAGAATTTATACAGAGTTTTGTAAAGGTTATACAGAGGGAATGC
    AAAAAATACATTAACTAAAATACGCAAGCTGGGAACAGTGACTTTTCAAGAAACATACCTCAGATAAATT
    AGATTGTCAATAACATTGAACTAAAAAGAACTTCACTTCTAGTCCTATTTGCACAGAATAAAAAAATAAA
    GAATAATAAAATCT
  • Protein Sequence : Show Sequence
    >gi|45383037|ref|NP_989902.1| interleukin 15 [Gallus gallus]
    MLGMAQPTQNSAGARRRPESQKTHVKSICLQYQLYLLLNSHFFCLLKNKTGLTIFFLCAYVPKTEANHCK
    WSDVLKDLELIKTSEDIDVSLYTANTYEDIECQEPVMRCFFLEMKVILHECDIKKCSRKHDVRNIWKNGN
    ARFATYQLNSTTAKKCKECEEYEEKNFTEFIQSFVKVIQRECKKYAN
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): E. maxima Gam82 protein vaccine
2. IL2
  • Gene Name : IL2
  • Sequence Strain (Species/Organism) : Gallus gallus
  • NCBI Gene ID : 373958
  • NCBI Protein GI : 49169785
  • Genbank Accession : AJ224516
  • Protein Accession : NP_989484
  • Taxonomy ID : 9031
  • Chromosome No : 4
  • Gene Starting Position : 53134198
  • Gene Ending Position : 53137243
  • Gene Strand (Orientation) : +
  • Protein Name : interleukin 2
  • Protein pI : 5.72
  • Protein Weight : 15833.1
  • Protein Length : 143
  • Protein Note : Also known as IL-2
  • DNA Sequence : Show Sequence
    >gi|358485508:53134198-53137243 Gallus gallus breed Red Jungle fowl, inbred line UCD001 chromosome 4, Gallus_gallus-4.0, whole genome shotgun sequence
    TATCACCTCACATTGTACATCACAATTTGAATACCAGCATACAGATAACTGGGACACTGCCATGATGTGC
    AAAGTACTGATCTTTGGCTGTATTTCGGTAGCAATGCTAATGACTACAGCTTATGGAGCATCTCTATCAT
    CAGCAAAAAGGAAACCTCTTCAAACATTAATAAAGGATTTAGAAATATTGGAAAATATCAAGAACGTAAG
    TGGATGGTTTTCCTCTATCAGTTCTTTTCTGCTAATGTTTTCTACTTATTTTATCAATGCATTTTGTCTT
    CAAAAATTAACTTTTCCTCCCTCTTCTCTACAGAAGATTCATCTCGAGCTCTACACACCAACTGAGACCC
    AGGTGAGCTTTAGCCTTTTGTTTTCAGAAGGACTTCTAAGATATGGCTACTTTAAAATGATGTATTATTG
    ATTTAGACCAAAACAATTCACTTATCAGAAGGGACAATATAGAAAGCAAATGTGAGGTGCTTGAATTCAG
    TGTGAGGGTAGGATGGTTTCCTAAAATACACTTCTGCCTTTGATTTATATTCTTAAACATTAACAAGATA
    ATGAATGATATTACTTTCTTCGTCTGTGCAATACAAAACATACAACTAATCCTCTGTATTCATTTTGCTT
    ACCACACAGTTCAATTCACAAAAAAAAATGTTCTGTGAATCAATTATATGTTGTATAATATTTGCAGGAG
    GCAATACTGTTGTATCAACATTAGTATAAGAACAATTCTGAGAATGAAGGGTTAGAAACTTTTTAAATGC
    AGCAATATCCATAGGAAAATGCCCGTATTTTATCAAAACCAGATGCAGAGACAGTAGTTGGTTCTGTTTA
    ACAAGTTACAAATCTCCCACATCCCATCAATAATGAAACTTAATTATGCTCTAACTACCTCTTTCCAGAA
    GTAAAATGTAACCAACTCATCCTAGATATATTTAGCTGTAAATTCTTATTTTAAGGTGTTCTGTAAATAT
    GCAAGGCTTAGTTCCATGTCAATACCGTCACTGTGGTTTCTTTTTTTTTTTTCTAAAATACTGCATACCT
    GAGTCCAGGAGCATTCTAAGCACAGCATTATCACAGTCTATTTACCATTGACAGGTTGCTGACCTGAACA
    CTTTTTCTAATTTAGTGTGCAAGCAGCTAGCAAGAGTATCAATTTGTTTGTTACTGGGAAGTAGTTGAGA
    TACTTATGCAAGTTAACTACTTTGAGCCTTTAATTTAGTTTTTAATCCAACAGAATTCTCACATAACAGA
    AATTTTGTTTGAGTAAAGATTTAAAACCAGATTCTGCAACCACTTCCTTATCTGAGTCATTTTTCTTCTA
    TGCTGGCAAGATCAAGATGTAACTATCTCAGAGCTCCAGTGCTCAAATGCAGATGTGTAAGGCCAATTTA
    ATAGCATACTATCACCAAGTGCCTGAAAGAGCTTATAAGAGTGATGTGTAAAGCGATGTACCCATACTCA
    AGGTCAGGTAGCACACGACCCTGCCAAGGGCAAAGAGTTGGAATGAGATAGTCTATAAGGACTTCCTTCC
    AACCCAAGCAATTCTGTGCTTCTATGACATTCAACTGCAAGACCAGATATAGGCATTACATAAAGGAACC
    AAAGTGCATTTATTGAAGATTGCCACTGTAAAATAGAGGCTTTACTGGTAACTCTTTTCTTAATTTCCAC
    ACAAAGGATTTCCACACAACTGGAAAAAATGCTCAGTTTAAGAGCTAATACAGCAGCTTCATGTTCCCAA
    GAGATGTTCCATCATTTAAAATATCCTGTAAAGATTGTCTACATTTCAAAAGCTACAAGACACTAAGGCC
    ACTTGTAGAATCTTATAACGTGACTTGGAGGGAAAAATTGAACTATGTACTGTATAAAAGGGAAATCAAA
    TTCCTTCCTCATACAGGGAAAAAAGCAATGGGCAATTAAGAAAAAAAAAAATTCAAGTTTTTTCAGAGAA
    CGTTTTATATGTCCCTACTTAAGTGTTCCCGTGTCCCTACTGCAGGAGAGACTGGCAAAAATATTTTATA
    TAAATACTATATATATATTAATATGTATTGACTTTGATTACTGTATTAGGAGTGCACCCAGCAAACTCTG
    CAGTGTTACCTGGGAGAAGTGGTTACTCTGAAGAAAGAAACTGAAGATGACACTGAAATTAAAGAAGAAT
    TTGTAACTGCTATTCAAAATATCGAAAAGAACCTCAAGAGTCTTACGGTAGGTATTCTTTATGGTCAGTT
    AGTTAAAAACAAATGTGTTTCTGCAGTAATGAAAAAGAACATCAGAATCAGTCTTTTAGTTTTGCCTTAA
    GGCCTTTGTGTTATGGTTGCTTAAGAATATGGCATTTTGCACAAAAATCCTGTAATGTGAAACTACTTGA
    CAACATCTACTTGCATGAAAATCCAAAACTTTAAAACAGTTCTGAGCCAAACTAACTATACAAGTCAACA
    TTTTAAGAAGTATGAGATTTGTTTTCTTTGCTAAATCATGTAAGTCACCTTACAGTGCTTTTAGAAGGGT
    AGCAATTATTTACATAAGTAGTAGTTCAGAAAACTATGCCATAAATTCATGACTCTAAAACTATCTGGCA
    AGAGAGCTATCACCAATTAACCAAATTTATTGTACTGCAGGGTCTAAATCACACCGGAAGTGAATGCAAG
    ATCTGTGAAGCTAACAACAAGAAAAAATTTCCTGATTTTCTCCATGAACTGACCAACTTTGTGAGATATC
    TGCAAAAATAAGCAACTAATCATTTTTATTTTACTGCTATGTTATTTATTTAATTATTTAATTACAGATA
    ATTTATATATTTTATCCCGTGGCTAACTAATCTGCTGTCCATTCTGGGACCACTGTATGCTCTTAGTCTG
    GGTGATATGACGTCTGTTCTAAGATCATATTTGATCCTTTCTGTAAGCCCTACGGGCTCAAAATGTACGT
    TGGAAAACTGATTGATTCTCACTTTGTCGGTAAAGTGATATGTGTTTACTGAAAGAATTTTTAAAAGTCA
    CTTCTAGATGACATTTAATAAATTTCAGTAATATAT
  • Protein Sequence : Show Sequence
    >gi|49169785|ref|NP_989484.1| interleukin 2 precursor [Gallus gallus]
    MMCKVLIFGCISVAMLMTTAYGASLSSEKWKTLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQC
    YLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRY
    LQK
  • Molecule Role : Vaximmutor
  • Related Vaccine(s): E. maxima Gam82 protein vaccine
IV. Vaccine Information
1. CoxAbic
a. Tradename:
CoxAbic
b. Manufacturer:
Novartis AH
c. Vaccine Ontology ID:
VO_0001113
d. Type:
Inactivated or "killed" vaccine
e. Status:
Licensed
f. Host Species for Licensed Use:
Pig
g. Immunization Route
Intramuscular injection (i.m.)
h. Description
Gametocyte antigen(s); transmission blocking through maternal antibody transfer(Wallach, 1997)
2. E. maxima DNA vaccine pcDNA-Gam56
a. Vaccine Ontology ID:
VO_0004527
b. Type:
DNA vaccine
c. Status:
Research
d. Host Species as Laboratory Animal Model:
Chickens
e. Gene Engineering of gam56
  • Type: DNA vaccine construction
  • Description:
  • Detailed Gene Information: Click here.
f. Vector:
pcDNA3.1(zeo)+ (Xu et al., 2013)
g. Immunization Route
Intramuscular injection (i.m.)
h. Chicken Response
  • Vaccination Protocol: The DNA vaccine was injected intramuscularly to yellow feathered broilers of 1-week old at 3 dosages (25, 50, and 100 µg/chick). Injection was repeated once 1 week later (Xu et al., 2013).
  • Vaccine Immune Response Type: VO_0000286
  • Immune Response: Compared with control groups, the administration of pcDNA-Gam56 vaccine markedly increased the lymphocyte proliferation activity (P<0.05) at day 7 and 14 after the first immunization. The level of lymphocyte proliferation started to decrease on day 21 after the first immunization. A similar trend was seen in specific antibody levels (Xu et al., 2013).
  • Challenge Protocol: One week after the second injection, birds were challenged orally with 5×104 sporulated oocysts of E. maxima, then weighed and killed at day 8 post challenge (Xu et al., 2013).
  • Efficacy: Among the 3 pcDNA-Gam56 immunized groups, the median dosage group displayed the highest lymphocyte proliferation and antibody levels (P<0.05). The median dosage group had the greatest relative body weight gain (89.7%), and the greatest oocyst shedding reduction (53.7%) (Xu et al., 2013).
3. E. maxima Gam82 protein vaccine
a. Vaccine Ontology ID:
VO_0011467
b. Type:
Subunit vaccine
c. Status:
Research
d. Antigen
E. maxima 82 kDa gametocyte antigen (Gam82)
e. Gene Engineering of gam82
  • Type: Recombinant protein preparation
  • Description: The Gam82 coding sequence was amplified by PCR using Proof Start DNA polymerase (Qiagen, Valencia, CA). Amplicons were cloned into the pET28a (+) plasmid vector (Novagen/EMD Chemicals, Gibbstown, NJ) downstream from an NH2-terminal His6 epitope tag, plasmid clones were verified by sequence analysis, and used to transform competent Escherichia coli BL21 Star (Invitrogen). Eluted protein fractions were visualized on 10% SDS-acrylamide gels stained with Coomassie brilliant blue and on Western blots probed with horseradish peroxidase-conjugated anti-His monoclonal antibody (1:3000; Qiagen), and stored at −20 °C (Jang et al., 2010).
  • Detailed Gene Information: Click here.
f. Adjuvant: complete Freunds adjuvant
  • VO ID: VO_0000139
  • Description: Freund's complete adjuvant (FCA)
g. Immunization Route
Intramuscular injection (i.m.)
h. Chicken Response
  • Host Strain: Ross broiler
  • Vaccination Protocol: At 1 wk of age, chickens (30/group) were intramuscularly immunized with 100 μl of 300 or 600 μg/ml of recombinant Gam82 in Freund's complete adjuvant (FCA). Control animals received PBS in FCA. At 1 wk post-immunization, animals were given a booster injection with 100 μl of 300 or 600 μg/ml of recombinant Gam82, 3-1E, or PBS in Freund's incomplete adjuvant Ref1077:Jang et al., 2010].
  • Challenge Protocol: At 7 d post-secondary immunization, animals were given PBS or 2.0 × 104 E. maxima sporulated oocysts by oral gavage using an 18-gauge needle (Jang et al., 2010).
  • Efficacy: Animals vaccinated with Gam82 and challenged with E. maxima showed lower oocyst shedding and reduced intestinal pathology compared with non-vaccinated and parasite-challenged animals. Gam82 vaccination also stimulated the production of antigen-specific serum antibodies and induced greater levels of IL-2 and IL-15 mRNAs compared with non-vaccinated controls. These results demonstrate that the Gam82 recombinant protein protects against E. maxima and augments humoral and cell-mediated immunity (Jang et al., 2010).
  • Host Gene Response of IL15
    • Gene Response: Three and six days after second immunization with 60 micrograms of Gam82, there was a significant difference in IL-15 mRNA levels between the immunized and non immunized (PBS vaccinated) groups of chickens. Levels were determined in intestinal tissue (Jang et al., 2010).
    • Detailed Gene Information: Click here.
  • Host Gene Response of IL2
    • Gene Response: Three days after second immunization with 60 micrograms of Gam82, there was a significant difference in IL-2 mRNA levels between the immunized and non immunized (PBS vaccinated) groups of chickens. Levels were determined in intestinal tissue (Jang et al., 2010).
    • Detailed Gene Information: Click here.
4. E. maxima oocysts with Arlacel A vaccine
a. Vaccine Ontology ID:
VO_0004229
b. Type:
Live, attenuated vaccine
c. Status:
Research
d. Adjuvant: arlacel A
e. Immunization Route
Intramuscular injection (i.m.)
f. Description
Chickens were vaccinated with Arlacel A injections prior to vaccination with E. maxima oocysts (Smith et al., 1994).
g. Chicken Response
  • Host Strain: Vedette
  • Vaccination Protocol: Hens were injected intramuscularly with 0.25 ml of PBS in 0.25 ml of Arlacel A in weeks 0, 2, and 6 of the study (Smith et al., 1994).
  • Challenge Protocol: At week 16 hens were infected with 20,000 oocysts of E. maxima (Smith et al., 1994).
  • Efficacy: None of the hens vaccinated had clinical symptoms of infection (Smith et al., 1994).
V. References
1. Huang et al., 2015: Huang J, Zhang Z, Li M, Song X, Yan R, Xu L, Li X. Immune protection of microneme 7 (EmMIC7) against Eimeria maxima challenge in chickens. Avian pathology : journal of the W.V.P.A. 2015; 44(5); 392-400. [PubMed: 26181095].
2. Huang et al., 2015: Huang J, Zhang Z, Li M, Song X, Yan R, Xu L, Li X. Eimeria maxima microneme protein 2 delivered as DNA vaccine and recombinant protein induces immunity against experimental homogenous challenge. Parasitology international. 2015; 64(5); 408-416. [PubMed: 26072304].
3. Jang et al., 2010: Jang SI, Lillehoj HS, Lee SH, Lee KW, Park MS, Cha SR, Lillehoj EP, Subramanian BM, Sriraman R, Srinivasan VA. Eimeria maxima recombinant Gam82 gametocyte antigen vaccine protects against coccidiosis and augments humoral and cell-mediated immunity. Vaccine. 2010; 28(17); 2980-2985. [PubMed: 20178868].
4. Jang et al., 2010: Jang SI, Lillehoj HS, Lee SH, Lee KW, Park MS, Cha SR, Lillehoj EP, Subramanian BM, Sriraman R, Srinivasan VA. Eimeria maxima recombinant Gam82 gametocyte antigen vaccine protects against coccidiosis and augments humoral and cell-mediated immunity. Vaccine. 2010; 28(17); 2980-2985. [PubMed: 20178868].
5. Smith et al., 1994: Smith NC, Wallach M, Miller CM, Morgenstern R, Braun R, Eckert J. Maternal transmission of immunity to Eimeria maxima: enzyme-linked immunosorbent assay analysis of protective antibodies induced by infection. Infection and immunity. 1994; 62(4); 1348-1357. [PubMed: 8132342].
6. Smith et al., 2002: Smith AL, Hesketh P, Archer A, Shirley MW. Antigenic diversity in Eimeria maxima and the influence of host genetics and immunization schedule on cross-protective immunity. Infection and immunity. 2002; 70(5); 2472-2479. [PubMed: 11953384].
7. Wallach, 1997: Wallach M. The importance of transmission-blocking immunity in the control of infections by apicomplexan parasites. International journal for parasitology. 1997; 27(10); 1159-1167. [PubMed: 9394186].
8. Witcombe et al., 2004: Witcombe DM, Ferguson DJ, Belli SI, Wallach MG, Smith NC. Eimeria maxima TRAP family protein EmTFP250: subcellular localisation and induction of immune responses by immunisation with a recombinant C-terminal derivative. International journal for parasitology. 2004; 34(7); 861-872. [PubMed: 15157769].
9. Xu et al., 2013: Xu J, Zhang Y, Tao J. Efficacy of a DNA vaccine carrying Eimeria maxima Gam56 antigen gene against coccidiosis in chickens. The Korean journal of parasitology. 2013; 51(2); 147-154. [PubMed: 23710081].