VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


EsxA (ESAT-6)

General Information
Protegen ID 104
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0010919
Taxonomy ID 83332
Other Database IDs EMBL: AE000516
EMBL: AF004671
EMBL: AF420491
EMBL: BX842584
EMBL: X79562
GenomeReviews: AE000516_GR
GenomeReviews: AL123456_GR
InterPro: IPR010310
KEGG: mtc:MT3989
KEGG: mtu:Rv3875
PDB: 1WA8
Pfam: PF06013
PIR: A70803
TIGR: MT3989
TubercuList: Rv3875
UniProt: P0A564
Molecule Role Protective antigen
Molecule Role Annotation The heterologous prime-boost strategy of live Salmonella vaccine expressing Mycobacterium tuberculosis fusion antigen Age5B-ESAT6 (esxA) from the chromosome followed by a systemic boost of antigen and adjuvant reduced the levels of M. tuberculosis bacteria in the lungs and spleen to the same extent as BCG. Additionally, this vaccination regimen was observed to be statistically equivalent in terms of protection to immunisation with BCG (Hall et al., 2009).
In a prophylactic vaccine model, immunization with the Mycobacterium tuberculosis protein ESAT-6 with LANAC adjuvant elicited significant protective immunity against aerosol challenge with virulent M. tuberculosis (Zaks et al., 2006).
COG COG4842S, under S: Function unknown
Related Vaccines(s) Ag85B and ESAT-6 fusion protein , attenuated M. bovis strain WAg539 , MVA/IL-15/5Mtb vaccine , recombinant S. typhimurium secreting M. tuberculosis ESAT-6
References
Hall et al., 2009: Hall LJ, Clare S, Pickard D, Clark SO, Kelly DL, El Ghany MA, Hale C, Dietrich J, Andersen P, Marsh PD, Dougan G. Characterisation of a live Salmonella vaccine stably expressing the Mycobacterium tuberculosis Ag85B-ESAT6 fusion protein. Vaccine. 2009; 27(49); 6894-6904. [PubMed: 19755145].
Zaks et al., 2006: Zaks K, Jordan M, Guth A, Sellins K, Kedl R, Izzo A, Bosio C, Dow S. Efficient immunization and cross-priming by vaccine adjuvants containing TLR3 or TLR9 agonists complexed to cationic liposomes. Journal of immunology (Baltimore, Md. : 1950). 2006; 176(12); 7335-7345. [PubMed: 16751377].
Gene Information
Gene Name EsxA (ESAT-6)
NCBI Gene ID 886209
Genbank Accession AL123456
Locus Tag Rv3875
Gene Starting Position 4352608
Gene Ending Position 4352895
DNA Sequence
>NC_000962.3:4352608-4352895 Mycobacterium tuberculosis H37Rv, complete genome
CATGACAGAGCAGCAGTGGAATTTCGCGGGTATCGAGGCCGCGGCAAGCGCAATCCAGGGAAATGTCACG
TCCATTCATTCCCTCCTTGACGAGGGGAAGCAGTCCCTGACCAAGCTCGCAGCGGCCTGGGGCGGTAGCG
GTTCGGAGGCGTACCAGGGTGTCCAGCAAAAATGGGACGCCACGGCTACCGAGCTGAACAACGCGCTGCA
GAACCTGGCGCGGACGATCAGCGAAGCCGGTCAGGCAATGGCTTCGACCGAAGGCAACGTCACTGGGATG
TTCGCATA

Protein Information
Protein Name ESAT-6 protein EsxA
NCBI Protein GI 57117165
Protein Accession YP_178023
Protein pI 4.19
Protein Weight 9605.81
Protein Length 95
Protein Note Rv3875, (MT3989, MTV027.10), len: 95 aa. esxA, early secretory antigenic target (see citations below), identical to Q57165|O84901|ESAT6 EARLY SECRETORY ANTIGENIC TARGET from Mycobacterium bovis (94 aa), FASTA scores: opt: 596, E(): 4.6e-33, (100.0% identity in 94 aa overlap). Also similar to Q50206|ESA6_MYCLE|ESAT6|ESX|L45|ML0049|MLCB628.12c 6 KDA EARLY SECRETORY ANTIGENIC TARGET HOMOLOG (ESAT-6-LIKE PROTEIN) (L-ESAT) from Mycobacterium leprae (95 aa), FASTA scores: opt: 236, E(): 3.3e-09, (36.25% identity in 91 aa overlap); and weak similarity with others proteins ESAT-like from Mycobacterium leprae. Also some similarity with O53266|ES69_MYCTU|Rv3019c|MT3104|MTV012.33c PUTATIVE SECRETED ESAT-6 LIKE PROTEIN 9 from Mycobacterium tuberculosis (96 aa), FASTA scores: opt: 131, E(): 0.03, (26.15% identity in 88 aa overlap); and other ESAT-like protein. Contains probable coiled-coil from 56 to 92 aa. BELONGS TO THE ESAT6 FAMILY. Note that previously known as esat-6.; esat-6
Protein Annotation FUNCTION: Not known. Elicits high level of IFN-gamma from memory effector cells during the first phase of a protective immune response (UniProt: P0A564)

SUBCELLULAR LOCATION: Secreted protein (UniProt: P0A564)

SIMILARITY: Belongs to the ESAT-6 (esx) family (UniProt: P0A564)
Protein Sequence
>YP_178023.1 ESAT-6 protein EsxA [Mycobacterium tuberculosis H37Rv]
MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQ
NLARTISEAGQAMASTEGNVTGMFA

Epitope Information
IEDB Linear Epitope