VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (50)
M. tuberculosis (26)
N. meningitidis (20)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo

Neisseria meningitidis

Table of Contents
  1. Protective Antigens
    1. ExbB
    2. GNA1030
    3. GNA1162
    4. GNA1220
    5. GNA1870
    6. GNA1946
    7. GNA2001
    8. GNA2091
    9. GNA2132
    10. GNA33
    11. GNA992 (hsf)
    12. gp120
    13. lctP
    14. lpdA
    15. NadA
    16. nspA
    17. NspA from N. meningitidis MC58
    18. P1
    19. TBP2
    20. tbpA
1. ExbB
  • Gene Name : ExbB
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0011186
  • NCBI Gene ID : 903370
  • NCBI Protein GI : 15677575
  • Locus Tag : NMB1729
  • Genbank Accession : AE002098
  • Protein Accession : NP_274732
  • Taxonomy ID : 122586
  • Gene Starting Position : 1812128
  • Gene Ending Position : 1812790
  • Gene Strand (Orientation) : -
  • Protein Name : biopolymer transport protein
  • Protein pI : 9.81
  • Protein Weight : 22358.4
  • Protein Length : 220
  • Protein Note : identified by similarity to EGAD:145333; match to protein family HMM PF01618
  • DNA Sequence : Show Sequence
    >NC_003112.2:1812128-1812790 Neisseria meningitidis MC58 chromosome, complete genome
    ATCAGCTATCCTTTTGATTAAGCAGGCGGACGTGCAAATCGTGCGCCATCGCATCCAAATCCTGGGTCAG
    TATTTTTGTGCCGCGATTGAGGAAGTTGTATGCCAACACCGCCGGAATCGCCACGAACAAACCCGCCGCC
    GTCGCCACCAGTGCCTCGCCAATCGGGCCGGCAACCGCCGCAATACTCATCTGCCCGCTTTGCCCGATAT
    TGATCAGGGCGTGGTAAATCCCCCAAACCGTGCCGAACAGCCCGATAAACGGCGCGGTCGCGCCGATGGA
    GGCAAGCGCGGTCATCCCGTAATCAAACCGGCGCATAATCTGCGCCATACTGTTGCGGATTTGAATGACC
    AAATACTCGTTCAACGGCAAAGCCTGCGCCAGTTCGGACGCTTCGTTTCGGCGGTAGTTGCGGTAAGACT
    GCAATGCCTCTTGCGCCAGTTTGGACAAAGGCGCATCGACGGCGCGCACTTTTTCGACCGCGTCGTTCAG
    CGACAAAGTATCGCGCATATGCCGTTTGACGGCGGCATTCCCTTTGCGCGCCCGATACAGCTTGATGCAG
    CGCAAGACAACCAAACACCACGTTACGATACTCATCAACAGCATCAACACAAACACACCAATCAGGACGG
    GATCGCCCGATTCAAACACTAATTTCAAATTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_274732.1 biopolymer transport protein [Neisseria meningitidis MC58]
    MNLKLVFESGDPVLIGVFVLMLLMSIVTWCLVVLRCIKLYRARKGNAAVKRHMRDTLSLNDAVEKVRAVD
    APLSKLAQEALQSYRNYRRNEASELAQALPLNEYLVIQIRNSMAQIMRRFDYGMTALASIGATAPFIGLF
    GTVWGIYHALINIGQSGQMSIAAVAGPIGEALVATAAGLFVAIPAVLAYNFLNRGTKILTQDLDAMAHDL
    HVRLLNQKDS
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A total of 11 meningococcal proteins that are necessary for establishing systemic infection were expressed as recombinant antigens and assessed for their ability to protect mice against live bacterial challenge against N. meningitidis; ExbB, which is required for iron acquisition, elicited protective immunity (Sun et al., 2005).
  • COG: COG0811U, under U: Intracellular trafficking, secretion, and vesicular transport
  • Related Vaccine(s): N. meningitidis ExbB Protein Vaccine
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=1)
  • Adhesin Probability: 0.244
  • Trans-membrane helices: 3
  • Detailed Vaxign Results Vaxign Results
2. GNA1030
  • Gene Name : GNA1030
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010983
  • NCBI Gene ID : 903167
  • NCBI Protein GI : 15676917
  • Locus Tag : NMB1030
  • Genbank Accession : AE002098
  • Protein Accession : NP_274064
  • Taxonomy ID : 122586
  • Gene Starting Position : 1045039
  • Gene Ending Position : 1045602
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 8.65
  • Protein Weight : 19439.53
  • Protein Length : 187
  • Protein Note : identified by similarity to EGAD:89838; match to protein family HMM PF04264
  • DNA Sequence : Show Sequence
    >NC_003112.2:1045039-1045602 Neisseria meningitidis MC58 chromosome, complete genome
    TTTATTGTTTGGCTGCCTCGATTTGGATGTCGATGCGGACGCTTTTGGTCATACCAACGTTAACGAGGTA
    GTCCATGCCCCATTTGGTGCGGTCGATGGTGGTGCTGAAGTCGCCGCCACAAACTTCGGTTTTCTCCATC
    GGGCTTTGGTAGCAGTTGAATTTTTCGGCTTTGAGTTTGACGGGGGCGGTTTTGCCGTGCATGGTCAGGT
    TGCCGTCAACGGAAACCAGTTTTTTGCCGTTGAAGTTGAATTTGGTGGAAACAAAGCGGATGTCCGGATA
    TTGGGCGGCATCGAAGATGTCGGCTGATTTCAGGTGGTCGGTAAAGTGTTGCGAACCGCTTTGCAGGTTG
    GCAATGGGGATGGTGATGTCGATTTTACCGTCGCGTTTTGCTTGGTCGAACTCGACGGAACCGGTCAGAC
    CGTAAAAACCGCCGACGTTGGTGCTGGTGTTGAAATGGTCGATGGCGAAACGGGCGTTGGCGTGATATTC
    GTCCACTTTGTAGGTGGCGGCGGAGGCAGTACTGATGGCGGCGGCTGCGAGTGCGGCGAAGATGATTTTT
    TTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_274064.1 hypothetical protein NMB1030 [Neisseria meningitidis MC58]
    MKKIIFAALAAAAISTASAATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQAKRDGKIDITIP
    IANLQSGSQHFTDHLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAPVKLKAEKFNCYQ
    SPMEKTEVCGGDFSTTIDRTKWGMDYLVNVGMTKSVRIDIQIEAAKQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen as shown in some assays (Giuliani et al., 2006)
  • COG: COG2353S, under S: Function unknown
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.727
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
3. GNA1162
  • Gene Name : GNA1162
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010976
  • NCBI Gene ID : 903582
  • NCBI Protein GI : 15677037
  • Locus Tag : NMB1162
  • Genbank Accession : AE002098
  • Protein Accession : NP_274189
  • Taxonomy ID : 122586
  • Gene Starting Position : 1167697
  • Gene Ending Position : 1168344
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 6.26
  • Protein Weight : 20946.7
  • Protein Length : 215
  • DNA Sequence : Show Sequence
    >NC_003112.2:1167697-1168344 Neisseria meningitidis MC58 chromosome, complete genome
    CTTATTTGGGCTGCTCTTCAACGAATCTCGGACCTTTCAAGATGCCGTTGTGAGAATAGGGCGACAGCAG
    GTTGTATGCGGCGGTTTTGGAAACCTGATAACCGCGGTCGGTCAGGCTGTTGGCAATCTGATTGACCACT
    GCGCTGACCAAAGCCCCCAACAGGCCGCTGTTGCTGTTGTTGCTGCCTTCGCGGATGCTGGCCGAACCCG
    ACCACAACTCTTTTCCGTTGCGGGAATCGACCAGCCGTGCTTTGGCGGATACGGTCGTCACGCTGTCTAA
    AATTTGATATGAAGTGCCGTATTCGGTAACCGTAATGTACAAAACCGCATCATTGCCGAAAATCTGATGC
    AGTTTTTCCGGCCGGACGGCGTGAATATCGGCGGCATTGGTCAAGCCGTTTTGTTTGAAGGTTTCCTCCA
    CGACTGCGGCGGGGAAGACGTAATAGCCGGCTTCGGAAAGCGGCGCGGCGGTCGAAGCCAGTACACCCCA
    TGTTCCGTTGACATCGGGCGATTCGTTCAGCGGCGGAACCACCAAAATTGAAGCCGGTTTGCTTTCCTTG
    AATGACGTGTAGTCGAAATCGGGCGCTTTTTGAACTTGGCAGGCAGACAGCGCCAACACGGCGGCAAGCC
    CTAAAATCAAAGGTTTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_274189.1 hypothetical protein NMB1162 [Neisseria meningitidis MC58]
    MKPLILGLAAVLALSACQVQKAPDFDYTSFKESKPASILVVPPLNESPDVNGTWGVLASTAAPLSEAGYY
    VFPAAVVEETFKQNGLTNAADIHAVRPEKLHQIFGNDAVLYITVTEYGTSYQILDSVTTVSAKARLVDSR
    NGKELWSGSASIREGSNNSNSGLLGALVSAVVNQIANSLTDRGYQVSKTAAYNLLSPYSHNGILKGPRFV
    EEQPK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen(Pizza et al., 2000)
  • COG: COG4380S, under S: Function unknown
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.672
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
4. GNA1220
  • Gene Name : GNA1220
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010975
  • NCBI Gene ID : 903642
  • NCBI Protein GI : 15677093
  • Locus Tag : NMB1220
  • Genbank Accession : AE002098
  • Protein Accession : NP_274245
  • Taxonomy ID : 122586
  • Gene Starting Position : 1224371
  • Gene Ending Position : 1225318
  • Gene Strand (Orientation) : -
  • Protein Name : hypothetical protein
  • Protein pI : 5.52
  • Protein Weight : 32124.16
  • Protein Length : 315
  • Protein Note : identified by similarity to GP:2984585; match to protein family HMM PF01145
  • DNA Sequence : Show Sequence
    >NC_003112.2:1224371-1225318 Neisseria meningitidis MC58 chromosome, complete genome
    CTTATTTGGCGGTTTTGCTGCTGTCGATAATTTTCATACCGGCAGAAATCAGGCTGCCGATGTCGGCAAC
    ATTGGCGGGCATAATCAGCGTATTGCTTTCTTTGGCAAGATTGTTGAACGCAGCGACGTATTGTTCCGCA
    ATCTTCAGATTGACCGCATCCGCACCGCCTTGGGTTTGAAGGGCGGCGGCAATTTGACGGATGGCTTCGG
    CATTGGCTTCGGCAACAAGGCGCAAGGATTCCGCTTCACCTTTGGCGCGGTTGATGCGGGCGATTTTCTC
    GGCATTTGACGCATTGACCGCAGCCTGAGCCTCGCCTTCGGATTGTTGGATTTCGGCTTCGCGCTGACCA
    CTGGCAAGGTTGATTTGTTCGATTTTACGACCTTCGGATTCGGCGATACGGGCGCGTTTTTCGCGTTCGG
    CAGTAATTTGCGCCTGCATTGAGCGAAGGATTTCTTGCGGCGGAACCAAGTCTTTAATCTCATAACGCAA
    AACCTTCACACCCCAAGCCCCGGCCGCCTCGTCCAAAGCCGCAACAACAGTACTGTTGATTTCGTCGCGT
    TCTTCAAACGTTTTGTCCAACTCCATACGCCCGATAACGGAACGCAGCGTCGTTTGGGCAAGCTGGGTAA
    TCGCCATAATGTAGTTGCTCGAACCGTATGAGGCGAGTTTGGGGTCGGTTACTTGGAAATAGATGATGCC
    GTCAACAGTCAGCTGCGTATTGTCGCGCGTGATGCAGACCTGGCTGGGTACGTCTAAAGGGATTTCTTTC
    AGCGAATGGCGGTAGGCGACGCGGTCGATAAAGGGAATCAAAATATTCAAACCGGCCGTCAGGGCGCGAT
    GGAAACGCCCCAGCCTTTCGACAACGTGGACTTCCTGTTGTGGGATGACAACAAAGGATTTGAAACCGAA
    AACGGCGACGGCTACCAACAAGATAATGAAAAATTCCA
    
    
  • Protein Sequence : Show Sequence
    >NP_274245.1 hypothetical protein NMB1220 [Neisseria meningitidis MC58]
    MEFFIILLVAVAVFGFKSFVVIPQQEVHVVERLGRFHRALTAGLNILIPFIDRVAYRHSLKEIPLDVPSQ
    VCITRDNTQLTVDGIIYFQVTDPKLASYGSSNYIMAITQLAQTTLRSVIGRMELDKTFEERDEINSTVVA
    ALDEAAGAWGVKVLRYEIKDLVPPQEILRSMQAQITAEREKRARIAESEGRKIEQINLASGQREAEIQQS
    EGEAQAAVNASNAEKIARINRAKGEAESLRLVAEANAEAIRQIAAALQTQGGADAVNLKIAEQYVAAFNN
    LAKESNTLIMPANVADIGSLISAGMKIIDSSKTAK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
  • COG: COG0330O, under O: Posttranslational modification, protein turnover, chaperones
  • Localization(Probability): Cytoplasmic
    (Prob.=0.896)
  • Adhesin Probability: 0.329
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
5. GNA1870
  • Gene Name : GNA1870
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010981
  • NCBI Gene ID : 904318
  • NCBI Protein GI : 15677705
  • Locus Tag : NMB1870
  • Genbank Accession : AE002098
  • Protein Accession : NP_274866
  • 3D structure: PDB ID : 1YS5
  • Taxonomy ID : 122586
  • Gene Starting Position : 1975217
  • Gene Ending Position : 1976179
  • Gene Strand (Orientation) : +
  • Protein Name : hypothetical protein
  • Protein pI : 9.11
  • Protein Weight : 32796.64
  • Protein Length : 320
  • Protein Note : also named factor H-binding protein (fHbp) or rLP-2086 (Pizza et al., 2008).
  • DNA Sequence : Show Sequence
    >NC_003112.2:1975217-1976179 Neisseria meningitidis MC58 chromosome, complete genome
    AATGCCGTCTGAACCGCCGTTCGGACGACATTTGATTTTTGCTTCTTTGACCTGCCTCATTGATGCGGTA
    TGCAAAAAAAGATACCATAACCAAAATGTTTATATATTATCTATTCTGCGTATGACTAGGAGTAAACCTG
    TGAATCGAACTGCCTTCTGCTGCCTTTCTCTGACCACTGCCCTGATTCTGACCGCCTGCAGCAGCGGAGG
    GGGTGGTGTCGCCGCCGACATCGGTGCGGGGCTTGCCGATGCACTAACCGCACCGCTCGACCATAAAGAC
    AAAGGTTTGCAGTCTTTGACGCTGGATCAGTCCGTCAGGAAAAACGAGAAACTGAAGCTGGCGGCACAAG
    GTGCGGAAAAAACTTATGGAAACGGTGACAGCCTCAATACGGGCAAATTGAAGAACGACAAGGTCAGCCG
    TTTCGACTTTATCCGCCAAATCGAAGTGGACGGGCAGCTCATTACCTTGGAGAGTGGAGAGTTCCAAGTA
    TACAAACAAAGCCATTCCGCCTTAACCGCCTTTCAGACCGAGCAAATACAAGATTCGGAGCATTCCGGGA
    AGATGGTTGCGAAACGCCAGTTCAGAATCGGCGACATAGCGGGCGAACATACATCTTTTGACAAGCTTCC
    CGAAGGCGGCAGGGCGACATATCGCGGGACGGCGTTCGGTTCAGACGATGCCGGCGGAAAACTGACCTAC
    ACCATAGATTTCGCCGCCAAGCAGGGAAACGGCAAAATCGAACATTTGAAATCGCCAGAACTCAATGTCG
    ACCTGGCCGCCGCCGATATCAAGCCGGATGGAAAACGCCATGCCGTCATCAGCGGTTCCGTCCTTTACAA
    CCAAGCCGAGAAAGGCAGTTACTCCCTCGGTATCTTTGGCGGAAAAGCCCAGGAAGTTGCCGGCAGCGCG
    GAAGTGAAAACCGTAAACGGCATACGCCATATCGGCCTTGCCGCCAAGCAATA
    
    
  • Protein Sequence : Show Sequence
    >NP_274866.1 hypothetical protein NMB1870 [Neisseria meningitidis MC58]
    MPSEPPFGRHLIFASLTCLIDAVCKKRYHNQNVYILSILRMTRSKPVNRTAFCCLSLTTALILTACSSGG
    GGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSR
    FDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLP
    EGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYN
    QAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Giuliani et al., 2006)
  • Localization(Probability): Unknown
    (Prob.=0.2)
  • Adhesin Probability: 0.803
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
6. GNA1946
  • Gene Name : GNA1946
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010974
  • NCBI Gene ID : 904205
  • NCBI Protein GI : 15677776
  • Locus Tag : NMB1946
  • Genbank Accession : AE002098
  • Protein Accession : NP_274940
  • 3D structure: PDB ID : 3GXA
  • Taxonomy ID : 122586
  • Gene Starting Position : 2041081
  • Gene Ending Position : 2041944
  • Gene Strand (Orientation) : -
  • Protein Name : outer membrane lipoprotein
  • Protein pI : 4.96
  • Protein Weight : 29236.71
  • Protein Length : 287
  • Protein Note : identified by similarity to EGAD:30554; match to protein family HMM PF03180
  • DNA Sequence : Show Sequence
    >NC_003112.2:2041081-2041944 Neisseria meningitidis MC58 chromosome, complete genome
    CTTATTTGGCTGCGCCTTCATTCCATGCGGCAGGGGATTTGTAGCCCTCGAAGCGTTTGTGCGCGTAGGC
    TTTGAACGCGTCGGAGTTATAGGCCTCGGTTACGTCTTTAAGCCATTGGCTGTCTTTGTCGGCGGTTTTG
    ACGGCAGACCAGTTGACATAGGCAAAGCTCGGTTCTTGGAACAGGGCTTCGGTCAGCTTCATGCCGCTGC
    TTATGGCGTAGTTGCCGTTGACGACGGCAAAATCCACGTCGGCGCGGCTACGCGGCAGTTGCGCGGCTTC
    AAGCTCGACGATTTTGATGTTTTTCAGGTTCTCGGCGATGTCCGCTTTGGATGCGGTCAACGGATTGATG
    CCGTCTTTGAGTTTGATCCAACCCAGTTCGTCGAGCATCACCAAGACGCGGGCGAAGTTGGACGGGTCGT
    TGGGCGCGGATACGGTGCTGCCGTCTTTGACTTCTTCCAGCGATTTCAGCTTGCCCGGGTACAGTCCCAA
    AGGCGCGGTCGGCACTTGGAAGACTTCGGTGATGTCCAGATTGTGTTCTTTTTTGAAGTCGTCAAGATAG
    GGTTTGTGTTGGAAGACGTTGATGTCCAACTCGCCCTCAGCCAATGCCAGATTCGGGCGTACATAGTCGG
    TAAACTCGACCAGTTTGACGGTGTAGCCTTTTTTCTCCAGCTCGGCTTGGATTTGTTCTTTGACCATATC
    GCCGAAGTCGCCGACGGTCGTGCCGAAGACGATTTCTTTTTTCGCCGCGCCGTTGTCGGCGGCGGCAGAA
    GCGGATGCGGCGGGCGCGCTGTCTTTTTGACCGCCGCAGGCGGCGAGGATGAGCGCGAGTGCGGCGGCGG
    AAAGGGTTTTGAAGAAGGTTTTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_274940.1 outer membrane lipoprotein [Neisseria meningitidis MC58]
    MKTFFKTLSAAALALILAACGGQKDSAPAASASAAADNGAAKKEIVFGTTVGDFGDMVKEQIQAELEKKG
    YTVKLVEFTDYVRPNLALAEGELDINVFQHKPYLDDFKKEHNLDITEVFQVPTAPLGLYPGKLKSLEEVK
    DGSTVSAPNDPSNFARVLVMLDELGWIKLKDGINPLTASKADIAENLKNIKIVELEAAQLPRSRADVDFA
    VVNGNYAISSGMKLTEALFQEPSFAYVNWSAVKTADKDSQWLKDVTEAYNSDAFKAYAHKRFEGYKSPAA
    WNEGAAK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
  • COG: COG1464P, under P: Inorganic ion transport and metabolism
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=0.997)
  • Adhesin Probability: 0.677
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
7. GNA2001
  • Gene Name : GNA2001
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010947
  • NCBI Gene ID : 904124
  • NCBI Protein GI : 15677829
  • Locus Tag : NMB2001
  • Genbank Accession : AE002098
  • Protein Accession : NP_274993
  • Taxonomy ID : 122586
  • Gene Starting Position : 2114380
  • Gene Ending Position : 2115135
  • Gene Strand (Orientation) : +
  • Protein Name : hypothetical protein
  • Protein pI : 10.78
  • Protein Weight : 26229.95
  • Protein Length : 251
  • Protein Note : identified by similarity to EGAD:91561; match to protein family HMM PF00877
  • DNA Sequence : Show Sequence
    >NC_003112.2:2114380-2115135 Neisseria meningitidis MC58 chromosome, complete genome
    TATGGATTCTTTTTTCAAACCGGCAGTTTGGGCGGTTTTGTGGCTGATGTTTGCCGTCCGCCCCGCCCTT
    GCCGACGAGTTGACCAACCTGCTCAGCAGCCGCGAGCAGATTCTCAGACAGTTTGCCGAAGACGAACAGC
    CCGTTTTACCCATCAACCGAGCCCCCGCCCGGCGGGCGGGCAATGCCGACGAACTCATCGGCAGCGCGAT
    GGGGCTTAACGAACAGCCCGTTTTACCCGTCAACCGAGTCCCCGCCCGGCGGGCGGGCAATGCCGACGAA
    CTCATCGGCAACGCGATGGGGCTTAACGAACAGCCCGTTTTACCCGTCAACCGAGCCCCCGCCCGGCGGG
    CGGGCAATGCCGACGAACTCATCGGCAACGCGATGGGACTTTTGGGTATTGCCTACCGCTACGGCGGCAC
    ATCGGTTTCTACCGGTTTTGACTGCAGCGGCTTCATGCAGCACATCTTCAAACGCGCCATGGGCATCAAC
    CTGCCGCGCACGTCGGCAGAACAGGCACGGATGGGTACGCCGGTTGCCCGAAGCGAATTGCAGCCCGGAG
    ATATGGTGTTTTTCCGCACGCTCGGCGGCAGCCGCATTTCCCATGTCGGACTTTATATCGGCAACAACCG
    CTTCATCCACGCGCCGCGCACGGGGAAAAATATCGAAATCACCAGCCTGAGCCACAAATATTGGAGCGGC
    AAATACGCGTTCGCCCGCCGGGTCAAGAAAAACGACCCGTCCCGCTTTCTGAACTG
    
    
  • Protein Sequence : Show Sequence
    >NP_274993.1 hypothetical protein NMB2001 [Neisseria meningitidis MC58]
    MDSFFKPAVWAVLWLMFAVRPALADELTNLLSSREQILRQFAEDEQPVLPINRAPARRAGNADELIGSAM
    GLNEQPVLPVNRVPARRAGNADELIGNAMGLNEQPVLPVNRAPARRAGNADELIGNAMGLLGIAYRYGGT
    SVSTGFDCSGFMQHIFKRAMGINLPRTSAEQARMGTPVARSELQPGDMVFFRTLGGSRISHVGLYIGNNR
    FIHAPRTGKNIEITSLSHKYWSGKYAFARRVKKNDPSRFLN
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
  • COG: COG0791M, under M: Cell wall/membrane/envelope biogenesis
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.137
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
8. GNA2091
  • Gene Name : GNA2091
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010982
  • NCBI Gene ID : 903958
  • NCBI Protein GI : 15677911
  • Locus Tag : NMB2091
  • Genbank Accession : AE002098
  • Protein Accession : NP_275079
  • Taxonomy ID : 122586
  • Gene Starting Position : 2211862
  • Gene Ending Position : 2212470
  • Gene Strand (Orientation) : +
  • Protein Name : hemolysin
  • Protein pI : 10.22
  • Protein Weight : 19563.68
  • Protein Length : 202
  • Protein Note : identified by similarity to EGAD:28637; match to protein family HMM PF04972
  • DNA Sequence : Show Sequence
    >NC_003112.2:2211862-2212470 Neisseria meningitidis MC58 chromosome, complete genome
    GATGAAACCCAAACCGCACACCGTCCGCACCCTGATTGCCGCCATTTTCAGCCTTGCCCTTAGCGGCTGC
    GTCAGCGCAGTAATCGGAAGCGCCGCCGTCGGCGCGAAATCCGCCGTCGACCGCCGAACCACCGGCGCGC
    AAACCGACGACAACGTTATGGCGTTGCGTATCGAAACCACCGCCCGTTCCTATCTGCGCCAAAACAACCA
    AACCAAAGGCTACACGCCCCAAATCTCCGTCGTCGGCTACAACCGCCACCTGCTGCTGCTCGGACAAGTC
    GCCACCGAAGGCGAAAAACAGTTCGTCGGTCAGATTGCACGTTCCGAACAGGCCGCCGAAGGCGTGTACA
    ACTATATTACCGTCGCCTCCCTGCCGCGCACTGCCGGCGACATCGCCGGCGACACTTGGAACACATCCAA
    AGTCCGCGCCACGCTGTTGGGCATCAGCCCCGCCACACAGGCGCGCGTCAAAATCGTTACCTACGGCAAC
    GTAACCTACGTTATGGGCATCCTCACCCCCGAAGAACAGGCGCAGATTACCCAAAAAGTCAGCACCACCG
    TCGGCGTACAAAAAGTCATCACCCTCTACCAAAACTACGTCCAACGCTG
    
    
  • Protein Sequence : Show Sequence
    >NP_275079.1 hemolysin [Neisseria meningitidis MC58]
    MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQ
    TKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTAGDIAGDTWNTSK
    VRATLLGISPATQARVKIVTYGNVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen as shown in some assays (Giuliani et al., 2006)
  • COG: COG2823R, under R: General function prediction only
  • Localization(Probability): Periplasmic
    (Prob.=0.944)
  • Adhesin Probability: 0.572
  • Trans-membrane helices: 1
  • Detailed Vaxign Results Vaxign Results
9. GNA2132
  • Gene Name : GNA2132
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010946
  • NCBI Gene ID : 903357
  • NCBI Protein GI : 15677945
  • Locus Tag : NMB2132
  • Genbank Accession : AE002098
  • Protein Accession : NP_275117
  • Taxonomy ID : 122586
  • Gene Starting Position : 2238475
  • Gene Ending Position : 2239941
  • Gene Strand (Orientation) : -
  • Protein Name : transferrin-binding protein-like protein
  • Protein pI : 4.57
  • Protein Weight : 48171.55
  • Protein Length : 488
  • Protein Note : identified by similarity to EGAD:39989; match to protein family HMM PF01298
  • DNA Sequence : Show Sequence
    >NC_003112.2:2238475-2239941 Neisseria meningitidis MC58 chromosome, complete genome
    ATCAATCCTGCTCTTTTTTGCCGGCAAACACGCCGAATCCGCCCTTTTCCGCATCTGTCGGGCGATAGCT
    GTATTTTCCCGCCACTTCCTCGCCGGCCGGGCCGTAAAACTTTCCGGAAACATCCCCGCTGCCATTTTCC
    GTCCAAGTCCCCTTAAAGCCGTTTCCATCGATGGCGGCTTTGAATTTTTGCGTACCCATATGCAAATCAT
    CGCCGCTGTCGATAATGCCGTCCACAGATTTGCTGCCGAAATCGACTTTTGCGGCAAACCTGCCCCTGGT
    CGGGTACGGACGGCCGTTTTCCGTATGGAAATGCAGTACTTCGCCGTTGTACACGGCCGCGCCCGCAAGC
    ATTTCGCCTTTTGCCGGTTCGCCTTGAACACGAAGGGCATACGATCCGCCGGGCAATTTTTCCGCCCCGT
    AAGTCAGATACCGGTAATTCCCTTCGGGCGCGAAGATATTGCCGGAATGCCCCGTCAGGCTGACCGCTTC
    CCCATCGACAATCAGCGTATCCGCCTGATTGACGGGAATCAGCGGCATCTCGGCCGGAAGCGACCGCCTC
    GACCGTGCAGAACGCCTAAATCGCGCAAATGAAGTGGGTTTAGGTTTATAAAAGATAATATATTGATTGA
    TTCCCTTCATCTGCACACTATCGGCAACCAAACCGACAAATTTATCATTCTTCCCATCTTTCTTGTAATT
    ACTTATTTTGTCTGCATCACTTAATTTTTCAAATTCTGATTTTAGCTGTACTTCTTCATCCAAGAAATTA
    TTGCCACTACAAGAATCGCCTTTACAGTGGGTCAACGTTATATTTTGCGACGGCCCGTCAATCAAAACGC
    CATTAGCCAAATCAACCCTTCCAAAATTGCTACCGCCATTCGCAGGTGCAGGGTTTGACGCGGGGATGGG
    ATCTGAAGAACCGGCGGCTTGATTGTTTCCGGCTTGATTTGCACCTTGGGCAGCCGTATTGCCGGCATTT
    TGCCCGCCTGCCGACGGATCGTCCCCCTGCATTCCGTCCGCCGCATTTGCCATATCCGGTTGGTTTGCCG
    GCTGAGACGATTCCCCGGCATCCGTTGCTTGATTTTCCATATTTCCGGCAAGCATATTCGGATCCGGGGT
    GTGATTCGGTGTCGAACTATCTGTACCGGCGGCATTTTGCGGCATATCATTTTGTGCCACCTCGTCTTCA
    TTTTTGGGATTATCCGCTGTTACCGCACCGCCATTGCCTGTATTTTCTTCCGAAACCGCCGCCATATCTT
    GACTGCCTTGTGCGGATGGCGCGCCCTGTCCTTGAGAACCTGCCTGTGGCGCATCTTCCTTTGCCTCTGT
    CTCTTTTTCAGAAACAACAGGGGCGGCAGGTTTTGACAGCGTGTCCGCCGACTTGACATCGGGCGATCCG
    CCACCGCCGCCCCCGCAGGCTGAAAGGGCAAAAATACAAGCCATTGCGATTACGCTGCGTTTAAACA
    
    
  • Protein Sequence : Show Sequence
    >NP_275117.1 transferrin-binding protein-like protein [Neisseria meningitidis MC58]
    MFKRSVIAMACIFALSACGGGGGGSPDVKSADTLSKPAAPVVSEKETEAKEDAPQAGSQGQGAPSAQGSQ
    DMAAVSEENTGNGGAVTADNPKNEDEVAQNDMPQNAAGTDSSTPNHTPDPNMLAGNMENQATDAGESSQP
    ANQPDMANAADGMQGDDPSAGGQNAGNTAAQGANQAGNNQAAGSSDPIPASNPAPANGGSNFGRVDLANG
    VLIDGPSQNITLTHCKGDSCSGNNFLDEEVQLKSEFEKLSDADKISNYKKDGKNDKFVGLVADSVQMKGI
    NQYIIFYKPKPTSFARFRRSARSRRSLPAEMPLIPVNQADTLIVDGEAVSLTGHSGNIFAPEGNYRYLTY
    GAEKLPGGSYALRVQGEPAKGEMLAGAAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGD
    DLHMGTQKFKAAIDGNGFKGTWTENGSGDVSGKFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQD
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000).
  • Localization(Probability): Periplasmic
    (Prob.=0.984)
  • Adhesin Probability: 0.545
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
10. GNA33
  • Gene Name : GNA33
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010978
  • NCBI Gene ID : 902136
  • NCBI Protein GI : 15675973
  • Locus Tag : NMB0033
  • Genbank Accession : AE002098
  • Protein Accession : NP_273099
  • Taxonomy ID : 122586
  • Gene Starting Position : 30910
  • Gene Ending Position : 32235
  • Gene Strand (Orientation) : -
  • Protein Name : membrane-bound lytic murein transglycosylase A
  • Protein pI : 10.02
  • Protein Weight : 45724.72
  • Protein Length : 441
  • Protein Note : identified by similarity to GP:974447; match to protein family HMM PF03562; match to protein family HMM PF06725
  • DNA Sequence : Show Sequence
    >NC_003112.2:30910-32235 Neisseria meningitidis MC58 chromosome, complete genome
    TTTACGGGCGGTATTCGGGCTTCATACCGTTGGGTAGGAGCTGCCAGACATATCCCGTGGTTTTCTGTTT
    GCCGGCAAGTTCGCCGGCTTCGTCGCCGTATCCCCAAAAATAATCCACGCGCACCGCGCCTTTAATCGCG
    CTGCCGGTATCCTGCGCCATAATCAGGCGGTTGAGGGCTTTGCGGGTAACCGGATGGGCGGTGGCGACAA
    ATAAGGGCGCACCCAAGGTAATGTAGTGCCGGTCGACTGCGCCGGCATATTCCCCCATCAGCGGCGTGCC
    CAGTGCGCCGACAGGGCCGTCATTGCTGCTTCCGGCAAGCTCGCGGAAAAAGATATAGCTGGGGTTTTGA
    CCCAAAACTTCGGCGAGGCGTTGCGGATTTTGCCGCATATAAGACTTAATGCCCTGCATGGAGGTTTGTC
    CGAGTTTGAGGTAGCCCTTATCCGCCATATAGCGTCCGATGGAAACGTAGGGATGTTCGTTTTTGTCGGC
    ATAGCCGATGCGGATGTATTTGCCGGACGGGGTTTTCAGACGGCCCGAGCCTTGGATGTGCATAAAAAAA
    AGTTCGACAGGGTCTTCGGCGTAACCGAGTATCGGGGCTTTGCCGTCAAGCGCGCCGCCGTTGATTTGGT
    TGCGCGTGTGGTAGGGGAGGAAGCGGCTTCCTTCAAACCTGCCTTTGATTGCTGTTGTGCGCGCGGTGAT
    GGGGAATCGGGAGAGGTCGGCGGTATGTGTGCCGCCGGTATTGTCGATTGTGCCGCTGTTTTTTCCCGTC
    TGCCTGATGCGGACAAGGGCTTTTCCGCTCCGCAAACCGGCAGGCAGGGGGACGGAGATAAAATCGTCGG
    GAATACCGTAAATCGGGAAGCGGGCTTGTGCCGTCCGCCTGTCGTCGCCCTTCAGCACCGGTTCGTAATA
    GCCGGTAACCGTACCGGCAAGGCTTCCGTTGCCTGCAACCTGCCACGGCGTGAAATAGCGTTCAAAAAAC
    TGTTTTGCCTGAAAGGAATGGACGGGGGTTTGAAAGGCTTGGGCGCACACATCCTGCCAGCCTTGGCGGT
    TTTTCAAATTGGCGCAGCCGAGGCGGAAGGATTGCAGGCTTTTGGCGAAATCCTGCGCCGCCCAGTGGGG
    CAGGGACAGGTGCGGTACAACGGTATAGACGGCCCCGCCGCCGCCGACCGTCGTTCCGGCGGGGTCGGGG
    ATGCCGACCGGCCGGTCCGGGCCGTTGATGACGGATGTGTCGGGTTGCGGAAAGGTTTGGATGCTCTTGC
    TTTGGCAGGCGGCGAGGATGGCGGCGGCGATGCCGTACAGGGCGGCGCGGAATAGGTATTTTTTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_273099.1 membrane-bound lytic murein transglycosylase A [Neisseria meningitidis MC58]
    MKKYLFRAALYGIAAAILAACQSKSIQTFPQPDTSVINGPDRPVGIPDPAGTTVGGGGAVYTVVPHLSLP
    HWAAQDFAKSLQSFRLGCANLKNRQGWQDVCAQAFQTPVHSFQAKQFFERYFTPWQVAGNGSLAGTVTGY
    YEPVLKGDDRRTAQARFPIYGIPDDFISVPLPAGLRSGKALVRIRQTGKNSGTIDNTGGTHTADLSRFPI
    TARTTAIKGRFEGSRFLPYHTRNQINGGALDGKAPILGYAEDPVELFFMHIQGSGRLKTPSGKYIRIGYA
    DKNEHPYVSIGRYMADKGYLKLGQTSMQGIKSYMRQNPQRLAEVLGQNPSYIFFRELAGSSNDGPVGALG
    TPLMGEYAGAVDRHYITLGAPLFVATAHPVTRKALNRLIMAQDTGSAIKGAVRVDYFWGYGDEAGELAGK
    QKTTGYVWQLLPNGMKPEYRP
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
  • COG: COG2821M, under M: Cell wall/membrane/envelope biogenesis
  • Localization(Probability): Outer Membrane
    (Prob.=0.992)
  • Adhesin Probability: 0.759
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
11. GNA992 (hsf)
  • Gene Name : GNA992 (hsf)
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010977
  • NCBI Gene ID : 903112
  • NCBI Protein GI : 15676883
  • Locus Tag : NMB0992
  • Genbank Accession : AE002098
  • Protein Accession : NP_274028
  • Taxonomy ID : 122586
  • Gene Starting Position : 1005588
  • Gene Ending Position : 1007363
  • Gene Strand (Orientation) : -
  • Protein Name : adhesin
  • Protein pI : 5.98
  • Protein Weight : 56655.27
  • Protein Length : 591
  • Protein Note : identified by similarity to EGAD:131908; match to protein family HMM PF03895; match to protein family HMM PF05662
  • Protein Annotation : hsf or called GNA992
  • DNA Sequence : Show Sequence
    >NC_003112.2:1005588-1007363 Neisseria meningitidis MC58 chromosome, complete genome
    CTTACCACTGATAACCGACAGATGCGGAAGCACCGAAATGGCCGCGCGAATTGCCGGAAGCCGTGCCTTT
    GATAATCCAATTTCCGCCGTCGGAAATACTGGAGTAGCCGATGGCGTAACCGGCTTCGCCGCGATAAGTG
    CCGCCGCCGATCGCCATCATACTCTTGCCGGGCAAATACGCCTGAACCAGACCTGCGGTTGCAATCGCTT
    GGGCGATGCCCGCACGCGCGTTGCCGTCCACATTGTCGATGCGGTTGTTCAAGTTTTGCGCCACGCCTTT
    AAGTTGTGCGACGTTTGTAACATCCCCCTCTTTAACGCCCGGGGCGACATTGGTAATGCGGACGGGTTTG
    TTGTCCTTCTTGCTGCCGACATTCAATGCGTCCCCATCCACGCTCAAAGTGGGCGCATCCGCCCCCGCGC
    CGAGCGAAACGCTGGAAAACTGCGGGGTCATCGAAGTGGCGATGTCGATATTTTTACCGTTGCGGGTAAT
    CTCGATGTTGTTGCCGGCATTAATGTTGACGGTTTCATCCATCTTTCCCTTGCTCGGCGAAACATTGCCG
    CTGATGACTTTGCCCGAAGAACCTGCAACCGCTTTGGAATCCAAATTCCAACCGCTGTTTTGCAGCTGAT
    TGACGTTTAGGGCATCGCCGACATTTACATCATACATAACAGTGATGTTGCCTTGATCATCTTTACTTAC
    AGTCGCAGTTGTACCTTTACCACTAGCAAAGGTTACATTTGTGCCTGATGTAACGGTTTCAAACTTGTCA
    GCTTGACCTGTTTGACCATTAGCGGTTGTTGTTTTCATTCTCCAACCAGCCTTGTTTACTGCATCAATCA
    CTTCTTTTGCAGTCACTAAGCCTTCGCCTTCGTCTGTAGAAGAACCATTCTCGCCTTTGTCTTTACCAGT
    AACCAACTTACCGTCTTTTTCTTTAATAACAGAAGTCTTCGCACCGATTTTAACTTCGGTTTTCTTGCCG
    TTGTCTTTGCTTTCCACATTAACAGTCGTTGTTTTCGTATCTGCGCTCAAGAACTCGACTGTGTCGTAAG
    TGCGGACGAAATCAACGTTATCGGAAGCTGTTGTACCGGGTTTAACGCCTTTAATGTTCCAGCCAGCGTT
    TAATACGTCTTTAACGCTTGCCGCACGTTTTTTCTCGTCATCGGTAACGTTGTCGTTGGTTACGTTTGTG
    GTCGCTCCGGTATTCAGCAGCGTATCGGTCAAAGTCGAACCAATACCGTTCAGATGAACCGTGGTGTCGC
    CGTTCGTCCCAGCCGTTTCTTTCGCAAAATTCAAGCCTTTGGTGTCGCTTGTGATGTTGACTTTATTGCC
    GTTTGCGCTAAACGATAATTTTTCAGTTCCAACACTGGTCAGATCTGTGAGGTCTTTTTTCAGCGAGTAG
    GTGAAGTTTGTGCCGTTTTGTTTGATTTTCAGGTTGTCGCCGGCTTTGAGGGTGATTTCTCTGGCTGTTA
    GTACTCCTTTCTCGTTGAAATATACTGCCCAATCTGAATTTTCTTCTACTTTTTCTTTTTCTCCCGTGCC
    TTCTTTATCGGAATTGACTATCAACACGGCAACAGTGCGTTGTACGGGGTCTAAATATAAATCTTCTTCT
    TGCTCTTCATTGTTAGCACTTGCCTGAACCGTTGCAAACAACAGTGTCGCCAATACGGCGGTCTTCACGG
    TTGCGGAGGCGCGTTTGGTGTGGTTGCGTGTGAGCTCGGATACGACGACCCAGGCATTGAGGGCACTATT
    CCAAATGATGCGGTATATTTTGTTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_274028.1 adhesin [Neisseria meningitidis MC58]
    MNKIYRIIWNSALNAWVVVSELTRNHTKRASATVKTAVLATLLFATVQASANNEEQEEDLYLDPVQRTVA
    VLIVNSDKEGTGEKEKVEENSDWAVYFNEKGVLTAREITLKAGDNLKIKQNGTNFTYSLKKDLTDLTSVG
    TEKLSFSANGNKVNITSDTKGLNFAKETAGTNGDTTVHLNGIGSTLTDTLLNTGATTNVTNDNVTDDEKK
    RAASVKDVLNAGWNIKGVKPGTTASDNVDFVRTYDTVEFLSADTKTTTVNVESKDNGKKTEVKIGAKTSV
    IKEKDGKLVTGKDKGENGSSTDEGEGLVTAKEVIDAVNKAGWRMKTTTANGQTGQADKFETVTSGTNVTF
    ASGKGTTATVSKDDQGNITVMYDVNVGDALNVNQLQNSGWNLDSKAVAGSSGKVISGNVSPSKGKMDETV
    NINAGNNIEITRNGKNIDIATSMTPQFSSVSLGAGADAPTLSVDGDALNVGSKKDNKPVRITNVAPGVKE
    GDVTNVAQLKGVAQNLNNRIDNVDGNARAGIAQAIATAGLVQAYLPGKSMMAIGGGTYRGEAGYAIGYSS
    ISDGGNWIIKGTASGNSRGHFGASASVGYQW
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Pizza et al., 2000)
  • COG: COG5295UW, under U: Intracellular trafficking, secretion, and vesicular transport; W: Extracellular structures
  • Localization(Probability): Unknown
    (Prob.=0.25)
  • Adhesin Probability: 0.891
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
12. gp120
  • Gene Name : gp120
  • Sequence Strain (Species/Organism) : Human immunodeficiency virus 1
  • NCBI Protein GI : 2326505
  • Other Database IDs : CDD:278917
    GOA:O40515
    InterPro: IPR000777
    UniProtKB/TrEMBL: O40515
  • Taxonomy ID : 11676
  • Gene Strand (Orientation) : ?
  • Protein pI : 9.81
  • Protein Weight : 11668
  • Protein Length : 172
  • Protein Note : Envelope glycoprotein GP120; pfam00516
  • Protein Sequence : Show Sequence
    >CAA74764.1 gp120, partial [Human immunodeficiency virus 1]
    NGSLAEGEVVIRSENFTDNAKTIIVQLNESVVINCTRPNNNTRKNIHLGRGRSVYATEKIIGNVKQAHCN
    ISRAKWNDTLKQIVEKLREQFGKNKTIVFNQSSGGDPEI
    
    
  • Molecule Role : Protective antigen
  • Related Vaccine(s): N. meningitidis DNA vaccine P3A
  • Localization(Probability): Unknown
    (Prob.=0.2)
  • Adhesin Probability: 0.335
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
13. lctP
  • Gene Name : lctP
  • Sequence Strain (Species/Organism) : Neisseria meningitidis
  • VO ID : VO_0011185
  • NCBI Protein GI : 254667969
  • Other Database IDs : CDD:224535
    EnsemblGenomes-Gn:NMO_0425
    EnsemblGenomes-Tr:CBA04244
    GOA:C6S5G4
    InterPro: IPR003804
    UniProtKB/TrEMBL: C6S5G4
  • Taxonomy ID : 662598
  • Gene Strand (Orientation) : ?
  • Protein Name : L-lactate permease
  • Protein pI : 8.92
  • Protein Weight : 52305.14
  • Protein Length : 601
  • Protein Note : L-lactate permease [Energy production and conversion]; COG1620
  • Protein Sequence : Show Sequence
    >CBA04244.1 L-lactate permease [Neisseria meningitidis alpha14]
    MALFLSIFPIVLLIWLMVKKNSMPSYVALPITAVLIYAIKLFYFGDAGMLLNATAASGLVKTLTPITVIF
    GAIMFNRMMETTGCIDVIRKWLATISPNPVAQLMIIGWAFAFMIEGASGFGTPAAIAAPILMSLGFNPLK
    VAIFTLVMNSVPVSFGAVGTPTWFGFAPLNLSAEDILAIGRQTGVMHFFAGFVIPVIGLGFIVPWSEIRK
    NLGFVAIAVFSCTIPYVALAMVNEEFPSLVAGAIGLMVSVFAANQGWGLSKDHAKDPNAEKVPFAQVAKA
    LAPLGMLIGMLVVTRIKQLGIKGILTSKEEWFSFQLPFDLSKITVSDSLTITFGNIFGQDVSASYQTLYV
    PAWIPFVLTVWICILLYKTKFKDAWTIYSVTFNQTKKPLLALMGALIMVQLMLVGGDNSMVKIIGKEFAA
    MAGEHWVYFSPYLGAIGAFFSGSNTVSNLTFGPIQQQIALDTGLSVTLILALQSVGGAMGNMVCLNNIIA
    VCTVLDVKNSEGAIIKKTVIPMAIYGVIAVVAAMIFFL
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : A total of 11 meningococcal proteins that are necessary for establishing systemic infection were expressed as recombinant antigens and assessed for their ability to protect mice against live bacterial challenge against N. meningitidis; the lactate permease (LctP) elicited protective immunity (Sun et al., 2005).
  • Related Vaccine(s): N. meningitidis LctP Protein Vaccine
  • Localization(Probability): Cytoplasmic Membrane
    (Prob.=1)
  • Adhesin Probability: 0.351
  • Trans-membrane helices: 13
  • Detailed Vaxign Results Vaxign Results
14. lpdA
  • Gene Name : lpdA
  • Sequence Strain (Species/Organism) : Neisseria meningitidis
  • VO ID : VO_0011181
  • NCBI Protein GI : 1017430
  • Other Database IDs : CDD:133458
    CDD:304358
    CDD:180579
    CDD:278498
    CDD:280934
    GOA:Q51191
    HSSP: 1OJT
    InterPro: IPR000089
    InterPro: IPR000815
    InterPro: IPR001327
    InterPro: IPR003016
    InterPro: IPR004099
    InterPro: IPR006258
    InterPro: IPR011053
    InterPro: IPR012999
    InterPro: IPR013027
    InterPro: IPR016156
    UniProtKB/TrEMBL: Q51191
  • Taxonomy ID : 487
  • Gene Strand (Orientation) : ?
  • Protein Name : outer membrane protein P64k or PM-6
  • Protein pI : 4.94
  • Protein Weight : 56755.94
  • Protein Length : 685
  • Protein Note : Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; cd06849
  • Protein Sequence : Show Sequence
    >CAA57206.1 outer membrane protein P64k or PM-6, partial [Neisseria meningitidis]
    MALVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDIPAEVAGVVKEVKVKVGDKISEG
    GLIVVVEAEGAATAPKAEAPATPAQEAPKAAAPAPQAAQFGGSADAEYDVVLGGGPGGYSAAFAAADEGL
    KVAIVERYKTLGGVCLNVGCIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRAYKNGVVSRLTGG
    LAGMAKRRKVDVIQGDGQFLDPHHLEVSLTAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDP
    RIIDSSGALALKEVPGKLLIIGAGIIGLEMGTVYSTLGSRLDVVEMMDGLMQGADRDLVKVWQKQNEYRF
    DNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGKLISAEKAGVAVTDRGFIEVDK
    QMRTNVPHIYAIVDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVAWVGETELSAKA
    SGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADIG
    KTIHPHPTLGESIGMAAEVALGTCTDLPPQKKK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Sera of the challenge group immunized with CCPS-P64kR showed a three-fold higher bactericidal response than the sera of the group immunized with the plain CCPS and they were able to protect against challenge with Neisseria meningococci in the infant rat protection model (Carmenate et al., 2004).
  • Related Vaccine(s): CCPS-P64kR
  • Localization(Probability): Cytoplasmic
    (Prob.=0.997)
  • Adhesin Probability: 0.215
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
15. NadA
  • Gene Name : NadA
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010980
  • NCBI Gene ID : 904134
  • NCBI Protein GI : 15677822
  • Locus Tag : NMB1994
  • Genbank Accession : AE002098
  • Protein Accession : NP_274986
  • Taxonomy ID : 122586
  • Gene Starting Position : 2100382
  • Gene Ending Position : 2101476
  • Gene Strand (Orientation) : +
  • Protein Name : adhesin/invasin
  • Protein pI : 4.54
  • Protein Weight : 35292.78
  • Protein Length : 364
  • Protein Note : identified by similarity to GP:2735093; match to protein family HMM PF03895
  • DNA Sequence : Show Sequence
    >NC_003112.2:2100382-2101476 Neisseria meningitidis MC58 chromosome, complete genome
    AATGAGCATGAAACACTTTCCATCCAAAGTACTGACCACAGCCATCCTTGCCACTTTCTGTAGCGGCGCA
    CTGGCAGCCACAAGCGACGACGATGTTAAAAAAGCTGCCACTGTGGCCATTGTTGCTGCCTACAACAATG
    GCCAAGAAATCAACGGTTTCAAAGCTGGAGAGACCATCTACGACATTGGTGAAGACGGCACAATTACCCA
    AAAAGACGCAACTGCAGCCGATGTTGAAGCCGACGACTTTAAAGGTCTGGGTCTGAAAAAAGTCGTGACT
    AACCTGACCAAAACCGTCAATGAAAACAAACAAAACGTCGATGCCAAAGTAAAAGCTGCAGAATCTGAAA
    TAGAAAAGTTAACAACCAAGTTAGCAGACACTGATGCCGCTTTAGCAGATACTGATGCCGCTCTGGATGA
    AACCACCAACGCCTTGAATAAATTGGGAGAAAATATAACGACATTTGCTGAAGAGACTAAGACAAATATC
    GTAAAAATTGATGAAAAATTAGAAGCCGTGGCTGATACCGTCGACAAGCATGCCGAAGCATTCAACGATA
    TCGCCGATTCATTGGATGAAACCAACACTAAGGCAGACGAAGCCGTCAAAACCGCCAATGAAGCCAAACA
    GACGGCCGAAGAAACCAAACAAAACGTCGATGCCAAAGTAAAAGCTGCAGAAACTGCAGCAGGCAAAGCC
    GAAGCTGCCGCTGGCACAGCTAATACTGCAGCCGACAAGGCCGAAGCTGTCGCTGCAAAAGTTACCGACA
    TCAAAGCTGATATCGCTACGAACAAAGCTGATATTGCTAAAAACTCAGCACGCATCGACAGCTTGGACAA
    AAACGTAGCTAATCTGCGCAAAGAAACCCGCCAAGGCCTTGCAGAACAAGCCGCGCTCTCCGGCCTGTTC
    CAACCTTACAACGTGGGTCGGTTCAATGTAACGGCTGCAGTCGGCGGCTACAAATCCGAATCGGCAGTCG
    CCATCGGTACCGGCTTCCGCTTTACCGAAAACTTTGCCGCCAAAGCAGGCGTGGCAGTCGGCACTTCGTC
    CGGTTCTTCCGCAGCCTACCATGTCGGCGTCAATTACGAGTGGTA
    
    
  • Protein Sequence : Show Sequence
    >NP_274986.1 adhesin/invasin [Neisseria meningitidis MC58]
    MSMKHFPSKVLTTAILATFCSGALAATSDDDVKKAATVAIVAAYNNGQEINGFKAGETIYDIGEDGTITQ
    KDATAADVEADDFKGLGLKKVVTNLTKTVNENKQNVDAKVKAAESEIEKLTTKLADTDAALADTDAALDE
    TTNALNKLGENITTFAEETKTNIVKIDEKLEAVADTVDKHAEAFNDIADSLDETNTKADEAVKTANEAKQ
    TAEETKQNVDAKVKAAETAAGKAEAAAGTANTAADKAEAVAAKVTDIKADIATNKADIAKNSARIDSLDK
    NVANLRKETRQGLAEQAALSGLFQPYNVGRFNVTAAVGGYKSESAVAIGTGFRFTENFAAKAGVAVGTSS
    GSSAAYHVGVNYEW
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Giuliani et al., 2006; Comanducci et al., 2002). There is another nadA (quinolinate synthetase) [ Neisseria meningitidis MC58 ] with GeneID: 902509. However, according to sequence analysis, this nadA is not the same NadA that was found to be protective antigen (Giuliani et al., 2006; Comanducci et al., 2002).
  • Localization(Probability): Outer Membrane
    (Prob.=0.993)
  • Adhesin Probability: 0.894
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
16. nspA
  • Gene Name : nspA
  • Sequence Strain (Species/Organism) : Neisseria meningitidis
  • VO ID : VO_0011184
  • NCBI Protein GI : 5825543
  • 3D structure: PDB ID : 1P4T
  • Other Database IDs : CDD:308205
  • Taxonomy ID : 487
  • Gene Strand (Orientation) : ?
  • Protein Name : surface protein A
  • Protein pI : 9.92
  • Protein Weight : 17478.2
  • Protein Length : 233
  • Protein Note : Opacity family porin protein; pfam02462
  • Protein Sequence : Show Sequence
    >AAD53286.1 surface protein A [Neisseria meningitidis]
    MKKALATLIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDYTRYKN
    YKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPN
    VDLDAGYRYNYIGKVNTVKNVRSGELSVGVRVKF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : NspA-containing outer membrane vesicles conferred protection against otherwise lethal intraperitoneal challenge of mice with N. meningitidis serogroup B, and sera raised against them mediated opsonophagocytosis of meningococcal strains expressing this antigen (O'dwyer et al., 2004).
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.640
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
17. NspA from N. meningitidis MC58
  • Gene Name : NspA from N. meningitidis MC58
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0010979
  • NCBI Gene ID : 902774
  • NCBI Protein GI : 15676561
  • Locus Tag : NMB0663
  • Genbank Accession : AE002098
  • Protein Accession : NP_273705
  • 3D structure: PDB ID : 1P4T
  • Taxonomy ID : 122586
  • Gene Starting Position : 690297
  • Gene Ending Position : 690821
  • Gene Strand (Orientation) : -
  • Protein Name : outer membrane protein
  • Protein pI : 10.02
  • Protein Weight : 17106.9
  • Protein Length : 174
  • Protein Note : identified by similarity to EGAD:137514; match to protein family HMM PF02462
  • DNA Sequence : Show Sequence
    >NC_003112.2:690297-690821 Neisseria meningitidis MC58 chromosome, complete genome
    ATCAGAATTTGACGCGCACACCGGCGGACAGTTCGCCGGAACGGACGTTTTTGACAGTGTTGACTTTGCC
    GATGTAGTTGTAGCGGTAGCCGGCATCCAAATCGACATTCGGGGTAACGGCATAGCTTACGCCCGTCAAT
    ACGCCGAGGCCGATGGAGGTTTGGCTGAAGCTGTCGCTGCCGCCCAAGTCGACGGAGGCGCGGTTGAGGC
    TCAAGCGCGCGCCGAGATACGGTTTGACGGGCGATTGGGTGTCGAAGTCGTAAATGGCGGACGCGCCGAT
    GCTGTAAAGTTTGAAATCGGTGGATGGGGCTTTATAGTTTTTGTAGCGCGTGTAATCGACGGCGAAGCGG
    AGGTCGTTGATGCGGTAGCCTGCGGAGATGCGCGGGCTGAAGCCTTTGGCAGAACCTAAAGAGCTTGAGG
    CTTTTGCGTGTGCGGCATCGGCTTGGACGTAAAAGCCGGATGCGCCTTCCGCCAGTGCGGCGGCCGGGAG
    AGCGAGGGCAATCAGTGTGGCAAGTGCTTTTTTCA
    
    
  • Protein Sequence : Show Sequence
    >NP_273705.1 outer membrane protein [Neisseria meningitidis MC58]
    MKKALATLIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDYTRYKN
    YKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPN
    VDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Protective antigen (Martin et al., 1997)
  • COG: COG3637M, under M: Cell wall/membrane/envelope biogenesis
  • Related Vaccine(s): N. meningitidis NspA Protein Vaccine
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.664
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
18. P1
  • Gene Name : P1
  • Sequence Strain (Species/Organism) : Neisseria meningitidis MC58
  • VO ID : VO_0011180
  • NCBI Gene ID : 902192
  • NCBI Protein GI : 15676020
  • Locus Tag : NMB0088
  • Genbank Accession : AE002098
  • Protein Accession : NP_273150
  • Taxonomy ID : 122586
  • Gene Starting Position : 99776
  • Gene Ending Position : 101176
  • Gene Strand (Orientation) : -
  • Protein Name : outer membrane protein P1
  • Protein pI : 9.85
  • Protein Weight : 47342.37
  • Protein Length : 466
  • Protein Note : identified by similarity to EGAD:16317; match to protein family HMM PF03349
  • DNA Sequence : Show Sequence
    >NC_003112.2:99776-101176 Neisseria meningitidis MC58 chromosome, complete genome
    TTTATTTGAATTTGTAGGTGTATTGCAGACCGATGATGTCGGCGTGGTTTTTGAAACGTGCGGAAGACGC
    GCCTTTGCTGTCCACATCGTTGCCGCTTGCCTTCGCCGTGCGGTAGCTGGTGTCGTTGATGTGGATGTGG
    GTGTAGGCGGCATCGACGACGTGGTTTTTACCGATATGGTATTTCATACCGGCGGAGAACCAGATGCGGT
    TGCCGTCGGGTAGGCTGTTCATGCGGTAGTCGGCGTTGCGGACGGGCGATTTGTCAAAAGCGATGCCGGC
    GCGCAGTTGCAGCGGTTCGCTGATTTGATAAGAACCGCCGAAGCCGACTTTGTAGGTGTTGCGCCAGTTG
    GGGGTGATGGTGGTGCGGTCGGATTTGCCTTTGACGACGGTTTTTTCTTTTTCAAAAACCAGTTCCGCCT
    TATCGAAGCGGCTGTGGCGCGTCCAAGTTACGTCGCCGAACAGGTCGGCTTTATCGGACACTTTGTACAT
    ACCGTGTACGGACAAAGACTCAGGCGTAACGATTTTAACGCGGGCTTTTTCATTCGCCGTGTAGCCGTTT
    GCTGCAAGCATCGTACTCCACATTGCTTTCGCCGCCGCGCCGTCTGCCGCCCATTCGGCATCGCCTTTGA
    GCGTGTGCGAGACTTTGGAACGGTAGTTCACGCCCACGCGCGCACGGTCGTTGATGTCCCACATCCACGC
    CAGTTGGTAGCCGAAGCCCCAATCGCTGCCTTTGACATCGGCGTGTCCGTCGGCCTGAATTTTTGCAGCT
    TCGGCTACACCGTTAGGTTTGGGCGGTTTTGCCGTCAATATCTCTGCTTTACTCTTAATCCCCCAGTCGG
    CATATTTGCGCAGTTCGGCGGAAGTATGTTGGGCGATGATGCCTGCGCCGAAGGAATGGCGGTCGTTGAG
    TTTCCACGCGGCGACAGGTTCGACGGCGATGCTGGTCAGACCGAGTTTGTTGATGTTGTGGCGCAACACG
    GAATCTTTTTCGTATTCGGTGGCAGAGCCGAAGGGGACGTACACGCCCAAGCCCACGGTCAGATTGTCGT
    TGACTTTGTATGCGCCGTAGATGTGGGGCGCGACCGTGGTTTTGGTGATTTTGCCGCTTTTCGAACCTTG
    GACGGGAAGCCCGGTAAAGTCGGTGGCGGAATCCGCCTCATAATGAATGCTGGGCAGCACGATGTTGGCG
    TTGACGGAAATCTGGCTGCTGTCGAGTTTGGTCAGGCCGGCAGGGTTGTAGAAGATGGTCGATGCGTCGG
    CGGCTTCTGCGGCGGCGGCATTTGCCGTGCTTTGCGCGTTGACCGACTGTGTGCCGAAGTGGTAGCCGGA
    TGCGTGGACGGATGCGGCGGCAAAGGCAGTGCCGAGCAGCAGGACGGTTTTTTTCAGTGCGGAAGGGGTC
    A
    
    
  • Protein Sequence : Show Sequence
    >NP_273150.1 outer membrane protein P1 [Neisseria meningitidis MC58]
    MTPSALKKTVLLLGTAFAAASVHASGYHFGTQSVNAQSTANAAAAEAADASTIFYNPAGLTKLDSSQISV
    NANIVLPSIHYEADSATDFTGLPVQGSKSGKITKTTVAPHIYGAYKVNDNLTVGLGVYVPFGSATEYEKD
    SVLRHNINKLGLTSIAVEPVAAWKLNDRHSFGAGIIAQHTSAELRKYADWGIKSKAEILTAKPPKPNGVA
    EAAKIQADGHADVKGSDWGFGYQLAWMWDINDRARVGVNYRSKVSHTLKGDAEWAADGAAAKAMWSTMLA
    ANGYTANEKARVKIVTPESLSVHGMYKVSDKADLFGDVTWTRHSRFDKAELVFEKEKTVVKGKSDRTTIT
    PNWRNTYKVGFGGSYQISEPLQLRAGIAFDKSPVRNADYRMNSLPDGNRIWFSAGMKYHIGKNHVVDAAY
    THIHINDTSYRTAKASGNDVDSKGASSARFKNHADIIGLQYTYKFK
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Seventeen monoclonal antibodies to one of three main cell surface antigens of Neisseria meningitidis group B were tested for protective efficacy in the infant rat using as challenge seven strains of different class 2/3 protein serotypes. Survival of the animals was regularly obtained with antibodies to the P1 protein and to LPS (Saukkonen et al., 1989).
  • COG: COG2067I, under I: Lipid transport and metabolism
  • Localization(Probability): Outer Membrane
    (Prob.=0.993)
  • Adhesin Probability: 0.785
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
19. TBP2
  • Gene Name : TBP2
  • Sequence Strain (Species/Organism) : Neisseria meningitidis
  • VO ID : VO_0011182
  • NCBI Protein GI : 1017433
  • Other Database IDs : CDD:279621
    GOA:Q51287
    InterPro: IPR001677
    UniProtKB/TrEMBL: Q51287
  • Taxonomy ID : 487
  • Gene Strand (Orientation) : ?
  • Protein Name : transferrin-binding protein 2
  • Protein pI : 6.81
  • Protein Weight : 72920.34
  • Protein Length : 761
  • Protein Note : Transferrin binding protein-like solute binding protein; pfam01298
  • Protein Sequence : Show Sequence
    >CAA55541.1 TBP2, partial [Neisseria meningitidis]
    CLGGGGGSFDLDSVDTEAPRPAPKYQDVSSEKPQAQKDQGGYGFAMRLKRRNWYPSAKENEVKLNESDWE
    TTGLPSNPKNLPERQKSVIDQVETDGDSNNSNIYSSPYLTQSNHQNGNTGNGVNQPKNEVTDYKNFKYVY
    SGWFYKHAKREVNLAVEPKIAKNGDDGYIFYHGKDPSRQLPASGKITYKGVWHFATDTKRGQKFREIIQP
    SKNQGDRYSGFSGDDDEQYSNKNESMLKDGHEGYGFASNLEVDFDNKKLTGKLIRNNANQNNNTNNDKHT
    TQYYSLDATLKGNRFSGKAEATDKPKNDGETKEHPFVSDSSSLSGGFFGPQGEELGFRFLSNDQKVAVVG
    SAKTKDKPANGNTAEASGGTDAAASGGAAGTSSENSKLTTVLDAVELTHGGTAIKNLDNFSNAAQLVVDG
    IMIPLLPQNSTGKNNQPDQGKNGGTAFIYKTTYTPKNDDKDTKAQTVTGGTQTASNTAGDANGKTKTYEV
    EVCCSNLNYLKYGLLTRKTAGNTVGSGNSSPTAAAQTDAQSMFLQGERTDENKIPSEQNVVYRGSWYGHI
    ASSTSWSGNASDKEGGNRAEFTVNFGEKKITGTLTAENRQEATFTIDGKIEGNGFSGTAKTAELGFDLDQ
    KNTTRTPKAYITDAKVKGGFYGPKAEELGGWFAYSDDKQTKNATDASGNGNSASSATVVFGAKRQQPVQ
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Mice immunized with purified Tbp2 survived a lethal challenge to a similar degree as animals immunized with the Tbp1-Tbp2 complex, demonstrating that Tbp2 played an important role in the protective activity observed with the complex, eliciting antibodies that are not only bactericidal but also inhibitory for meningococcal growth (Lissolo et al., 1995).
  • Related Vaccine(s): N. miningitidis TBP2 Protein Vaccine
  • Localization(Probability): Unknown
    (Prob.=0.626)
  • Adhesin Probability: 0.800
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
20. tbpA
  • Gene Name : tbpA
  • Sequence Strain (Species/Organism) : Neisseria meningitidis K454
  • VO ID : VO_0012380
  • NCBI Protein GI : 8926211
  • Other Database IDs : CDD:273799
    CDD:238657
  • Taxonomy ID : 487
  • Gene Strand (Orientation) : ?
  • Protein Name : transferrin-binding protein A
  • Protein pI : 9.8
  • Protein Weight : 96910.19
  • Protein Length : 997
  • Protein Note : TbpA
  • Protein Sequence : Show Sequence
    >AAF81744.1 transferrin-binding protein A [Neisseria meningitidis]
    MQQQHLFRFNILCLSLMTALPAYAENVQAGQAQEKQLDTIQVKAKKQKTRRDNEVTGLGKLVKSSDTLSK
    EQVLNIRDLTRYDPGIAVVEQGRGASSGYSIRGMDKNRVSLTVDGVSQIQSYTAQAALGGTRTAGSSGAI
    NEIEYENVKAVEISKGSNSVEQGSGALAGSVAFQTKTADDVIGEGRQWGIQSKTAYSGKNRGLTQSIALA
    GRIGGAEALLIHTGRRAGEIRAHEDAGRGVQSFNRLVPVEDSSNYAYFIVKEECKNGSYETCKANPKKDV
    VGKDERQTVSTRDYTGPNRFLADPLSYESRSWLFRPGFRFENKRHYIGGILEHTQQTFDTRDMTVPAFLT
    KAVFDANKKQAGSLPGNGKYAGNHKYGGLFTNGENGALVGAEYGTGVFYDETHTKSRYGLEYVYTNADKD
    TWADYARLSYDRQGVGLDNHFQQTHCSADGSDKYCRPSADKPFSYYKSDRVIYGESHRLLQAAFKKSFDT
    AKIRHNLSVNLGFDRFGSNLRHQDYYYQHANRAYSSNTPPQNNGKKISPNGSETSPYWVTIGRGNVVTGQ
    ICRLGNNTYTDCTPRSINGKSYYAAVRDNVRLGRWADVGAGLRYDYRSTHSDDGSVSTGTHRTLSWNAGI
    VLKPTDWLDLTYRTSTGFRLPSFAEMYGWRAGVQSKAVKIDPEKSFNKEAGIVFKGDFGNLEASWFNNAY
    RDLIVRGYEAQIKDGKEEAKGDPAYLNAQSARITGINILGKIDWNGVWDKLPEGWYSTFAYNRVRVRDIK
    KRADRTDIQSHLFDAIQPSRYVVGLGYDQPEGKWGVNGMLTYSKAKEITELLGSRALLNGNSRNTKATAR
    RTRPWYIVDVSGYYTVKKHFTLRAGVYNLLNYRYVTWENVRQTAGGAVNQHKNVGVYNRYAAPGRNYTFS
    LEMKF
    
    
  • Molecule Role : Protective antigen
  • Molecule Role Annotation : Recombinant TbpA protein was used in a mouse intraperitoneal-infection model to determine their ability to protect against meningococcal infection and to induce cross-reactive and bactericidal antibodies. TbpA was found to afford protection against meningococcal challenge when administered as the sole immunogen (West et al., 2001).
  • Related Vaccine(s): N. meningitidis TbpA Protein Vaccine
  • Localization(Probability): Outer Membrane
    (Prob.=1)
  • Adhesin Probability: 0.570
  • Trans-membrane helices: 0
  • Detailed Vaxign Results Vaxign Results
II. References
1. Carmenate et al., 2004: Carmenate T, Canaán L, Alvarez A, Delgado M, González S, Menéndez T, Rodés L, Guillén G. Effect of conjugation methodology on the immunogenicity and protective efficacy of meningococcal group C polysaccharide-P64k protein conjugates. FEMS immunology and medical microbiology. 2004; 40(3); 193-199. [PubMed: 15039094].
2. Comanducci et al., 2002: Comanducci M, Bambini S, Brunelli B, Adu-Bobie J, Aricò B, Capecchi B, Giuliani MM, Masignani V, Santini L, Savino S, Granoff DM, Caugant DA, Pizza M, Rappuoli R, Mora M. NadA, a novel vaccine candidate of Neisseria meningitidis. The Journal of experimental medicine. 2002; 195(11); 1445-1454. [PubMed: 12045242].
3. Giuliani et al., 2006: Giuliani MM, Adu-Bobie J, Comanducci M, Aricò B, Savino S, Santini L, Brunelli B, Bambini S, Biolchi A, Capecchi B, Cartocci E, Ciucchi L, Di Marcello F, Ferlicca F, Galli B, Luzzi E, Masignani V, Serruto D, Veggi D, Contorni M, Morandi M, Bartalesi A, Cinotti V, Mannucci D, Titta F, Ovidi E, Welsch JA, Granoff D, Rappuoli R, Pizza M. A universal vaccine for serogroup B meningococcus. Proceedings of the National Academy of Sciences of the United States of America. 2006; 103(29); 10834-10839. [PubMed: 16825336].
4. Lissolo et al., 1995: Lissolo L, Maitre-Wilmotte G, Dumas P, Mignon M, Danve B, Quentin-Millet MJ. Evaluation of transferrin-binding protein 2 within the transferrin-binding protein complex as a potential antigen for future meningococcal vaccines. Infection and immunity. 1995; 63(3); 884-890. [PubMed: 7868259].
5. Martin et al., 1997: Martin D, Cadieux N, Hamel J, Brodeur BR. Highly conserved Neisseria meningitidis surface protein confers protection against experimental infection. The Journal of experimental medicine. 1997; 185(7); 1173-1183. [PubMed: 9104804].
6. O'dwyer et al., 2004: O'dwyer CA, Reddin K, Martin D, Taylor SC, Gorringe AR, Hudson MJ, Brodeur BR, Langford PR, Kroll JS. Expression of heterologous antigens in commensal Neisseria spp.: preservation of conformational epitopes with vaccine potential. Infection and immunity. 2004; 72(11); 6511-6518. [PubMed: 15501782].
7. Pizza et al., 2000: Pizza M, Scarlato V, Masignani V, Giuliani MM, Aricò B, Comanducci M, Jennings GT, Baldi L, Bartolini E, Capecchi B, Galeotti CL, Luzzi E, Manetti R, Marchetti E, Mora M, Nuti S, Ratti G, Santini L, Savino S, Scarselli M, Storni E, Zuo P, Broeker M, Hundt E, Knapp B, Blair E, Mason T, Tettelin H, Hood DW, Jeffries AC, Saunders NJ, Granoff DM, Venter JC, Moxon ER, Grandi G, Rappuoli R. Identification of vaccine candidates against serogroup B meningococcus by whole-genome sequencing. Science (New York, N.Y.). 2000; 287(5459); 1816-1820. [PubMed: 10710308].
8. Pizza et al., 2008: Pizza M, Donnelly J, Rappuoli R. Factor H-binding protein, a unique meningococcal vaccine antigen. Vaccine. 2008; 26 Suppl 8; I46-48. [PubMed: 19388164].
9. Saukkonen et al., 1989: Saukkonen K, Leinonen M, Abdillahi H, Poolman JT. Comparative evaluation of potential components for group B meningococcal vaccine by passive protection in the infant rat and in vitro bactericidal assay. Vaccine. 1989; 7(4); 325-328. [PubMed: 2510417].
10. Sun et al., 2005: Sun Y, Li Y, Exley RM, Winterbotham M, Ison C, Smith H, Tang CM. Identification of novel antigens that protect against systemic meningococcal infection. Vaccine. 2005; 23(32); 4136-4141. [PubMed: 15964482].
11. West et al., 2001: West D, Reddin K, Matheson M, Heath R, Funnell S, Hudson M, Robinson A, Gorringe A. Recombinant Neisseria meningitidis transferrin binding protein A protects against experimental meningococcal infection. Infection and immunity. 2001; 69(3); 1561-1567. [PubMed: 11179327].