DNA vaccine pVAX-P1 in a prime-boost mode was able to induce protection with reduced mortality, a significant (75.68%) decrease in splenic parasite burden and increased expression of Th1 type cytokines in immunized hamsters (Arora et al., 2011).
Ribosomal protein P1. This subfamily represents the eukaryotic large ribosomal protein P1. Eukaryotic P1 and P2 are functionally equivalent to the bacterial protein L7/L12, but are not homologous to L7/L12. P1 is located in the L12 stalk, with proteins...; cd05831
Protein Sequence
>AAN60108.1 ribosomal protein P1-like protein [Leishmania donovani]
MSAETLACTYAALMLSDAGLPTSAENIAAAVKAAGVEMRPTLPIIFARFLEKKSVETLMAAAAAQAPTAA
XAPSPAAGAASAAXXGGKVEDKKKDEPEEEGDDDMGFGLFD