The 10-kDa culture filtrate protein (CFP-10, esxB) and 6-kDa early secretory antigen of T cells (ESAT-6) are secreted in abundance by Mycobacterium tuberculosis. Study demonstrated that protective immunity is induced by CFP-10 DNA vaccination in C3H mice as measured by a CFU reduction in the lung and spleen 4 and 8 weeks after challenge with M. tuberculosis (Wu et al., 2008).
Wu et al., 2008: Wu Y, Woodworth JS, Shin DS, Morris S, Behar SM. Vaccine-elicited 10-kilodalton culture filtrate protein-specific CD8+ T cells are sufficient to mediate protection against Mycobacterium tuberculosis infection. Infection and immunity. 2008; 76(5); 2249-2255. [PubMed: 18332205].
Rv3874, (MT3988, MTV027.09), len: 100 aa. esxB, 10 KDA culture filtrate antigen (see citations below, especially first), highly similar to O33084|CF10_MYCLE|ML0050|MLCB628.13c 10 KDA CULTURE FILTRATE ANTIGEN CFP10 HOMOLOG from Mycobacterium leprae (99 aa), FASTA scores: opt: 237, E(): 2.4e-08, (39.4% identity in 99 aa overlap). Also similar to O05440|ES6D_MYCTU|Rv3905c|MT4024|MTCY15F10.06 PUTATIVE ESAT-6 LIKE PROTEIN 13 from Mycobacterium tuberculosis (103 aa) FASTA scores: opt: 126, E(): 0.18, (23.1% identity in 91 aa overlap); and shows some similarity with other proteins from Mycobacterium tuberculosis. Contains probable coiled-coil from aa 49-93. BELONGS TO THE ESAT6 FAMILY. Note that previously known as lhp (alternate gene name: cfp10).; lhp, cfp10
Protein Annotation
SUBCELLULAR LOCATION: Secreted protein (UniProt: P0A566)
SIMILARITY: Belongs to the ESAT-6 (esx) family (UniProt: P0A566)
Protein Sequence
>NP_218391.1 ESAT-6-like protein EsxB [Mycobacterium tuberculosis H37Rv]
MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELD
EISTNIRQAGVQYSRADEEQQQALSSQMGF
