VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


EsxB

General Information
Protegen ID 121
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0010951
Taxonomy ID 83332
Other Database IDs EMBL: AE000516
EMBL: AF004671
EMBL: AF419854
EMBL: BX842584
GenomeReviews: AE000516_GR
GenomeReviews: AL123456_GR
InterPro: IPR010310
KEGG: mtc:MT3988
KEGG: mtu:Rv3874
Pfam: PF06013
PIR: H70802
SMR: P0A566
TIGR: MT3988
TubercuList: Rv3874
UniProt: P0A566
Molecule Role Protective antigen
Molecule Role Annotation The 10-kDa culture filtrate protein (CFP-10, esxB) and 6-kDa early secretory antigen of T cells (ESAT-6) are secreted in abundance by Mycobacterium tuberculosis. Study demonstrated that protective immunity is induced by CFP-10 DNA vaccination in C3H mice as measured by a CFU reduction in the lung and spleen 4 and 8 weeks after challenge with M. tuberculosis (Wu et al., 2008).
Related Vaccines(s) attenuated M. bovis strain WAg539
References
Wu et al., 2008: Wu Y, Woodworth JS, Shin DS, Morris S, Behar SM. Vaccine-elicited 10-kilodalton culture filtrate protein-specific CD8+ T cells are sufficient to mediate protection against Mycobacterium tuberculosis infection. Infection and immunity. 2008; 76(5); 2249-2255. [PubMed: 18332205].
Gene Information
Gene Name EsxB
NCBI Gene ID 886194
Genbank Accession AF004671
Locus Tag Rv3874
Gene Starting Position 4352273
Gene Ending Position 4352575
DNA Sequence
>NC_000962.3:4352273-4352575 Mycobacterium tuberculosis H37Rv, complete genome
CATGGCAGAGATGAAGACCGATGCCGCTACCCTCGCGCAGGAGGCAGGTAATTTCGAGCGGATCTCCGGC
GACCTGAAAACCCAGATCGACCAGGTGGAGTCGACGGCAGGTTCGTTGCAGGGCCAGTGGCGCGGCGCGG
CGGGGACGGCCGCCCAGGCCGCGGTGGTGCGCTTCCAAGAAGCAGCCAATAAGCAGAAGCAGGAACTCGA
CGAGATCTCGACGAATATTCGTCAGGCCGGCGTCCAATACTCGAGGGCCGACGAGGAGCAGCAGCAGGCG
CTGTCCTCGCAAATGGGCTTCTG

Protein Information
Protein Name ESAT-6-like protein EsxB
NCBI Protein GI 15611010
Protein Accession NP_218391
3D structure: PDB ID 3FAV
Protein pI 4.31
Protein Weight 10396.66
Protein Length 100
Protein Note Rv3874, (MT3988, MTV027.09), len: 100 aa. esxB, 10 KDA culture filtrate antigen (see citations below, especially first), highly similar to O33084|CF10_MYCLE|ML0050|MLCB628.13c 10 KDA CULTURE FILTRATE ANTIGEN CFP10 HOMOLOG from Mycobacterium leprae (99 aa), FASTA scores: opt: 237, E(): 2.4e-08, (39.4% identity in 99 aa overlap). Also similar to O05440|ES6D_MYCTU|Rv3905c|MT4024|MTCY15F10.06 PUTATIVE ESAT-6 LIKE PROTEIN 13 from Mycobacterium tuberculosis (103 aa) FASTA scores: opt: 126, E(): 0.18, (23.1% identity in 91 aa overlap); and shows some similarity with other proteins from Mycobacterium tuberculosis. Contains probable coiled-coil from aa 49-93. BELONGS TO THE ESAT6 FAMILY. Note that previously known as lhp (alternate gene name: cfp10).; lhp, cfp10
Protein Annotation SUBCELLULAR LOCATION: Secreted protein (UniProt: P0A566)

SIMILARITY: Belongs to the ESAT-6 (esx) family (UniProt: P0A566)
Protein Sequence
>NP_218391.1 ESAT-6-like protein EsxB [Mycobacterium tuberculosis H37Rv]
MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELD
EISTNIRQAGVQYSRADEEQQQALSSQMGF

Epitope Information
IEDB Linear Epitope