VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


PepA

General Information
Protegen ID 123
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0010953
Taxonomy ID 83332
Molecule Role Protective antigen
COG COG0265O, under O: Posttranslational modification, protein turnover, chaperones
Related Vaccines(s) Mtb72f fusion protein
References  
Gene Information
Gene Name PepA
NCBI Gene ID 886924
Genbank Accession CP003248
Locus Tag Rv0125
Gene Starting Position 151147
Gene Ending Position 152214
DNA Sequence
>NC_000962.3:151147-152214 Mycobacterium tuberculosis H37Rv, complete genome
GATGAGCAATTCGCGCCGCCGCTCACTCAGGTGGTCATGGTTGCTGAGCGTGCTGGCTGCCGTCGGGCTG
GGCCTGGCCACGGCGCCGGCCCAGGCGGCCCCGCCGGCCTTGTCGCAGGACCGGTTCGCCGACTTCCCCG
CGCTGCCCCTCGACCCGTCCGCGATGGTCGCCCAAGTGGGGCCACAGGTGGTCAACATCAACACCAAACT
GGGCTACAACAACGCCGTGGGCGCCGGGACCGGCATCGTCATCGATCCCAACGGTGTCGTGCTGACCAAC
AACCACGTGATCGCGGGCGCCACCGACATCAATGCGTTCAGCGTCGGCTCCGGCCAAACCTACGGCGTCG
ATGTGGTCGGGTATGACCGCACCCAGGATGTCGCGGTGCTGCAGCTGCGCGGTGCCGGTGGCCTGCCGTC
GGCGGCGATCGGTGGCGGCGTCGCGGTTGGTGAGCCCGTCGTCGCGATGGGCAACAGCGGTGGGCAGGGC
GGAACGCCCCGTGCGGTGCCTGGCAGGGTGGTCGCGCTCGGCCAAACCGTGCAGGCGTCGGATTCGCTGA
CCGGTGCCGAAGAGACATTGAACGGGTTGATCCAGTTCGATGCCGCGATCCAGCCCGGTGATTCGGGCGG
GCCCGTCGTCAACGGCCTAGGACAGGTGGTCGGTATGAACACGGCCGCGTCCGATAACTTCCAGCTGTCC
CAGGGTGGGCAGGGATTCGCCATTCCGATCGGGCAGGCGATGGCGATCGCGGGCCAGATCCGATCGGGTG
GGGGGTCACCCACCGTTCATATCGGGCCTACCGCCTTCCTCGGCTTGGGTGTTGTCGACAACAACGGCAA
CGGCGCACGAGTCCAACGCGTGGTCGGGAGCGCTCCGGCGGCAAGTCTCGGCATCTCCACCGGCGACGTG
ATCACCGCGGTCGACGGCGCTCCGATCAACTCGGCCACCGCGATGGCGGACGCGCTTAACGGGCATCATC
CCGGTGACGTCATCTCGGTGACCTGGCAAACCAAGTCGGGCGGCACGCGTACAGGGAACGTGACATTGGC
CGAGGGACCCCCGGCCTG

Protein Information
Protein Name serine protease PepA
NCBI Protein GI 15607267
Protein Accession NP_214639
Protein pI 4.91
Protein Weight 30958.56
Protein Length 355
Protein Note Rv0125, (MTCI418B.07, MTB32A), len: 355 aa. Probable pepA (alternate gene name: mtb32a), serine protease (EC 3.4.21.-) (see Skeiky et al., 1999), highly similar to other proteases e.g. HHOB_ECOLI|P31137 protease hhob precursor (355 aa), FASTA scores: opt: 400, E(): 3.8e-14, (32.4% identity in 346 aa overlap). Also similar to Q50320 34 kDa PROTEIN PRECURSOR from Mycobacterium tuberculosis (361 aa), FASTA scores: opt: 1689, E(): 0, (70.7% identity in 362 aa overlap). Contains PS00135 Serine proteases, trypsin family, serine active site. Has a putative signal sequence at the N-terminus. BELONGS TO THE SERINE PROTEASE FAMILY.; mtb32a
Protein Sequence
>NP_214639.1 serine protease PepA [Mycobacterium tuberculosis H37Rv]
MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADFPALPLDPSAMVAQVGPQVVNINTKL
GYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPS
AAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGG
PVVNGLGQVVGMNTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGN
GARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLA
EGPPA

Vaxign Prediction
Localization(Probability) Unknown
(Prob.=0.333)
Adhesin Probability 0.636
Trans-membrane Helices 1
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope