interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone; located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side; mutations in the S12 gene confer streptomycin resistance
Protein Sequence
>gi|161511151|ref|NP_539669.2| 30S ribosomal protein S12 [Brucella melitensis 16M]
MPTVNQLIRKPRTAPVKRNKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGE
GHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK