S. flexneri M90T is a colonisation-defective mutant with a transposon in fnr, which encodes a regulator of anaerobic metabolism. To establish whether FNR-mediated repression of spa32 and spa33 contributes to increased Shigella entry into cells in an anaerobic cabinet, recombinant M90T strains were constructed which contain spa32 and spa33 under the control of either their native promoters (M90Tp32/33) or promoters with disrupted FNR boxes (M90Tp#32/#33).The presence in M90T of spa32 and spa33 alleles that are not repressed by FNR led to IpaB secretion during anaerobic growth, and loss of the increased entry of Shigella into cells in an anaerobic cabinet (Marteyn et al., 2010).
residues 1 to 292 of 292 are 100.00 pct identical to residues 1 to 292 of 292 of product encoded by GenBank Accession Number D50601 ORF20 [Shigella sonnei]
Protein Sequence
>NP_085314.1 invasion protein (plasmid) [Shigella flexneri 5a str. M90T]
MALDNINLNFSSDKQIEKCEKLSSIDNIDSLVLKKKRKVEIPEYSLIASNYFTIDKHFEHKHDKGEIYSG
IKNAFELRNERATYSDIPESMAIKENILIPDQDIKAREKINIGDMRGIFSYNKSGNADKNFERSHTSSVN
PDNLLESDNRNGQIGLKNHSLSIDKNIADIISLLNGSVAKSFELPVMNKNTADITPSMSLQEKSIVENDK
NVFQKNSEMTYHFKQWGAGHSVSISVESGSFVLKPSDQFVGNKLDLILKQDAEGNYRFDSSQHNKGNKNN
STGYNEQSEEEC
