VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (60)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


ipaD

General Information
Protegen ID 309
Sequence Strain (Species/Organism) Shigella flexneri 2a
VO ID VO_0010996
Taxonomy ID 42897
Other Database IDs CDD:297251
Molecule Role Protective antigen
Molecule Role Annotation The invasiveness and virulence of Shigella spp. are largely due to the expression of plasmid-encoded virulence factors, among which are the invasion plasmid antigens (IpaB, IpaC, and IpaD). Recent observations have indicated that the Ipa proteins (IpaB, IpaC, and possibly IpaD) form a multiprotein complex capable of inducing the phagocytic event which internalizes the bacterium. Researchers isolated a complex of invasins and LPS from water-extractable antigens of virulent shigellae. Western blot analysis of the complex indicates that all of the major virulence antigens of Shigella, including IpaB, IpaC, and IpaD, and LPS are components of this macromolecular complex. Guinea pigs (keratoconjunctivitis model) or mice (lethal lung model) immunized intranasally with purivied invasin complex (invaplex) on days 0, 14, and 28 and challenged 3 weeks later with virulent shigellae were protected from disease (P<0.01 for both animal models) (Turbyfill et al., 2000).
Related Vaccines(s) S. flexneri Invaplex 24 Subunit Vaccine , S. flexneri Invaplex 50 Subunit Vaccine
References
Turbyfill et al., 2000: Turbyfill KR, Hartman AB, Oaks EV. Isolation and characterization of a Shigella flexneri invasin complex subunit vaccine. Infection and immunity. 2000; 68(12); 6624-6632. [PubMed: 11083774].
Gene Information
Gene Name ipaD
Protein Information
Protein Name IpaD
NCBI Protein GI 22036352
3D structure: PDB ID 2J0O
Protein pI 6.14
Protein Weight 23805.99
Protein Length 282
Protein Note Invasion plasmid antigen IpaD; cl05827
Protein Sequence
>AAM89596.1 IpaD, partial (plasmid) [Shigella flexneri 2a]
IRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAEL
DGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVN
SLKKALEELKEKYKDKPLYPANNTVSQDQANKWLTELGGTIGKVSQKNRGYGVNINMPPIDNMLKSLDYL
GGNGEVVL

Epitope Information
IEDB Linear Epitope