VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


stx1B

General Information
Protegen ID 3964
Sequence Strain (Species/Organism) Escherichia coli O157
Taxonomy ID 1045010
Other Database IDs CDD:280428
GOA:Q8X4M7
HSSP: P69178
InterPro: IPR003189
InterPro: IPR008992
UniProtKB/TrEMBL: Q8X4M7
Molecule Role Protective antigen
Molecule Role Annotation In agreement with the data for serum IgG anti toxin immunogenicity, it appears that the construct producing the secreted form of the Stx1B EspP fusion was the most protective against challenge with a virulent Stx1 toxin producing rEPEC strain of a different serogroup. (Byrd et al., 2017)

Vaccination against both PNAG and Stx, using a construct such as the 9GlcNH2-Stx1b conjugate vaccine, would be protective (Lu et al., 2014).
References
Byrd et al., 2017: Byrd W, Ruiz-Perez F, Setty P, Zhu C, Boedeker EC. Secretion of the Shiga toxin B subunit (Stx1B) via an autotransporter protein optimizes the protective immune response to the antigen expressed in an attenuated E. coli (rEPEC E22Ξ”ler) vaccine strain. Veterinary microbiology. 2017; 211; 180-188. [PubMed: 29102116].
Lu et al., 2014: Lu X, Skurnik D, Pozzi C, Roux D, Cywes-Bentley C, Ritchie JM, Munera D, Gening ML, Tsvetkov YE, Nifantiev NE, Waldor MK, Pier GB. A Poly-N-acetylglucosamine-Shiga toxin broad-spectrum conjugate vaccine for Shiga toxin-producing Escherichia coli. mBio. 2014; 5(2); 00974-00914. [PubMed: 24667709].
Gene Information
Gene Name stx1B
Protein Information
Protein Name Shiga toxin Stx1 subunit B
NCBI Protein GI OWR88953
Protein pI 8.22
Protein Weight 9793.31
Protein Length 155
Protein Note Derived by automated computational analysis using gene prediction method: Protein Homology.
Protein Sequence
>OWR88953.1 Shiga toxin Stx1 subunit B [Escherichia coli O157]
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTV
TIKTNACHNGGGFSEVIFR
Epitope Information
IEDB Linear Epitope