VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


espA

General Information
Protegen ID 3977
Sequence Strain (Species/Organism) Escherichia coli O157:H7
Taxonomy ID 1286877
Molecule Role Protective antigen
Molecule Role Annotation Intranasal immunization protected against EHEC O157:H7 colonization and infection in mice at a rate of 90% (Lin et al., 2017).

Immunization of calves with recombinant EHEC O157 EspA, intimin and Tir resulted in the generation of antibodies capable of cross-reacting with antigens from non-O157 EHEC serotypes, suggesting that immunization with these antigens may provide a degree of cross-protection against other EHEC serotypes (McNeilly et al., 2015).
Related Vaccines(s) EspA-Tir-M novel fusion protein vaccine
References
Lin et al., 2017: Lin R, Zhu B, Zhang Y, Bai Y, Zhi F, Long B, Li Y, Wu Y, Wu X, Fan H. Intranasal immunization with novel EspA-Tir-M fusion protein induces protective immunity against enterohemorrhagic Escherichia coli O157:H7 challenge in mice. Microbial pathogenesis. 2017; 105; 19-24. [PubMed: 28163157].
McNeilly et al., 2015: McNeilly TN, Mitchell MC, Corbishley A, Nath M, Simmonds H, McAteer SP, Mahajan A, Low JC, Smith DG, Huntley JF, Gally DL. Optimizing the Protection of Cattle against Escherichia coli O157:H7 Colonization through Immunization with Different Combinations of H7 Flagellin, Tir, Intimin-531 or EspA. PloS one. 2015; 10(5); e0128391. [PubMed: 26020530].
Gene Information
Gene Name espA
Protein Information
Protein Name espA
NCBI Protein GI EIP05353
Protein pI 5.13
Protein Weight 15791.36
Protein Length 206
Protein Sequence
>EIP05353.1 espA [Escherichia coli O157:H7 str. TW14313]
MFSYMYQAQSNLSIAKFADMNEASKASTTAQKMANLVDAKIADVQSSTDKNAKAKLPQDVIDYINDPRND
ISVTGIRDLSGDLSAGDLQTVKAAISAKANNLTTVVNNSQLEIQQMSNTLNLLTSARSDVQSLQYRTISA
ISLGK
Vaxign Prediction
Localization(Probability) Unknown
(Prob.=0.2)
Adhesin Probability 0.753
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope