Bagnoli et al., 2015: Bagnoli F, Fontana MR, Soldaini E, Mishra RP, Fiaschi L, Cartocci E, Nardi-Dei V, Ruggiero P, Nosari S, De Falco MG, Lofano G, Marchi S, Galletti B, Mariotti P, Bacconi M, Torre A, Maccari S, Scarselli M, Rinaudo CD, Inoshima N, Savino S, Mori E, Rossi-Paccani S, Baudner B, Pallaoro M, Swennen E, Petracca R, Brettoni C, Liberatori S, Norais N, Monaci E, Bubeck Wardenburg J, Schneewind O, O'Hagan DT, Valiante NM, Bensi G, Bertholet S, De Gregorio E, Rappuoli R, Grandi G. Vaccine composition formulated with a novel TLR7-dependent adjuvant induces high and broad protection against Staphylococcus aureus. Proceedings of the National Academy of Sciences of the United States of America. 2015; 112(12); 3680-3685. [PubMed: 25775551].

>sp|A0A0H2XIE9.1|ESXB_STAA3 RecName: Full=ESAT-6 secretion system extracellular protein B; Short=Ess extracellular protein B
MGGYKGIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIEGSDWEGQFANKVKDVLLIMAKFQEELV
QPMADHQKAIDNLSQNLAKYDTLSIKQGLDRVNP