Gil et al., 2013: Gil LA, da Cunha CE, Moreira GM, Salvarani FM, Assis RA, Lobato FC, Mendonça M, Dellagostin OA, Conceição FR. Production and evaluation of a recombinant chimeric vaccine against clostridium botulinum neurotoxin types C and D. PloS one. 2013; 8(7); e69692. [PubMed: 23936080].
Downstream region of the type D botulinum neurotoxin gene cluster of phage d-1873; bacteriophage='d-1873'; type D'
Protein Sequence
>BAE53579.1 botulinum neurotoxin type D precursor, partial [Clostridium botulinum D phage]
KLYTGNPITIKSVSDKNPYSRILNGDNIILHMLYNSRKYMIIRDTDTIYATQGGECSQNCVYALKLQSNL
GNYGIGIFSIKNIVSKNKYCSQIFSSFRENTMLLADIYKPWRFSFKNAYTPVAVTNYETKLLSTSSFWKF
ISRDPGWVE
