Mice vaccinated with DCs transfected with individual Chlamydia protein PmpG-1(25-500), RplF, or PmpE/F-2(25-575) exhibited significant resistance to challenge infection. In addition, RplF was able to engender protective immunity against challenge with C. muridarum (Yu et al., 2009).
ribosomal protein L6 appears to have arisen as a result of an ancient gene duplication as based on structural comparison of the Bacillus stearothermophilus protein; RNA-binding appears to be in the C-terminal domain; mutations in the L6 gene confer resistance to aminoglycoside antibiotics such as gentamicin and these occur in truncations of the C-terminal domain; it has been localized to a region between the base of the L7/L12 stalk and the central protuberance
Protein Sequence
>WP_010231599.1 50S ribosomal protein L6 [Chlamydia muridarum]
MSRKARDPIVLPQGVEVSIQNDEISVKGPKGSLTQVLAKEVEIAVKGNEVFVSPAAHIIDRPGRMQGLYW
ALIANMVKGVHLGFEKRLEMIGVGFRASVQGSFLDLSIGVSHPTKMPIPTGLEVSVEKNTLISIKGINKQ
LVGEFAACVRAKRPPEPYKGKGIRYENEYVRRKAGKAAKTGKK