VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


PPE42

General Information
Protegen ID 4398
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
Taxonomy ID 83332
Other Database IDs CDD:307116
CDD:279771
CDD:311933
Molecule Role Protective antigen
Molecule Role Annotation ID93/GLA-SE protects against TB and MDR-TB in animals.
Related Vaccines(s) ID93/GLA-SE
References  
Gene Information
Gene Name PPE42
Protein Information
Protein Name PPE family protein PPE42
NCBI Protein GI YP_177893
Protein pI 4.26
Protein Weight 57135.65
Protein Length 663
Protein Note PPE family; pfam00823
Protein Sequence
>YP_177893.1 PPE family protein PPE42 [Mycobacterium tuberculosis H37Rv]
MNFAVLPPEVNSARIFAGAGLGPMLAAASAWDGLAEELHAAAGSFASVTTGLAGDAWHGPASLAMTRAAS
PYVGWLNTAAGQAAQAAGQARLAASAFEATLAATVSPAMVAANRTRLASLVAANLLGQNAPAIAAAEAEY
EQIWAQDVAAMFGYHSAASAVATQLAPIQEGLQQQLQNVLAQLASGNLGSGNVGVGNIGNDNIGNANIGF
GNRGDANIGIGNIGDRNLGIGNTGNWNIGIGITGNGQIGFGKPANPDVLVVGNGGPGVTALVMGGTDSLL
PLPNIPLLEYAARFITPVHPGYTATFLETPSQFFPFTGLNSLTYDVSVAQGVTNLHTAIMAQLAAGNEVV
VFGTSQSATIATFEMRYLQSLPAHLRPGLDELSFTLTGNPNRPDGGILTRFGFSIPQLGFTLSGATPADA
YPTVDYAFQYDGVNDFPKYPLNVFATANAIAGILFLHSGLIALPPDLASGVVQPVSSPDVLTTYILLPSQ
DLPLLVPLRAIPLLGNPLADLIQPDLRVLVELGYDRTAHQDVPSPFGLFPDVDWAEVAADLQQGAVQGVN
DALSGLGLPPPWQPALPRLF
Vaxign Prediction
Localization(Probability) Unknown
(Prob.=0.25)
Adhesin Probability 0.592
Trans-membrane Helices 0
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope