VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


E2

General Information
Protegen ID 442
Sequence Strain (Species/Organism) Classical swine fever virus strain LPC
VO ID VO_0010897
Taxonomy ID 11096
Other Database IDs CDD:292945
Molecule Role Protective antigen
Molecule Role Annotation Pigs were subjected to challenge infection with a dose of 1x10(5)TCID(50) (50% tissue culture infective dose) virulent CSFV strain. At 1 week post challenge infection, all of the yE2-immunized pigs were alive and without symptoms or signs of CSF. The yeast-expressed E2 protein retains correct immunogenicity and is able to induce a protective immune response against CSFV infection (Lin et al., 2009).

In a seperate study, swine vaccinated with VVR expressing E0 and/or E2 resisted a lethal challenge infection with CSFV. Glycoprotein E0 represents a second determinant for the induction of protective immunity against classical swine fever (König et al., 1995).
Related Vaccines(s) Classical swine fever virus vaccine VAC-E2 , rAdV-SFV-E2
References
König et al., 1995: König M, Lengsfeld T, Pauly T, Stark R, Thiel HJ. Classical swine fever virus: independent induction of protective immunity by two structural glycoproteins. Journal of virology. 1995; 69(10); 6479-6486. [PubMed: 7666549].
Lin et al., 2009: Lin GJ, Liu TY, Tseng YY, Chen ZW, You CC, Hsuan SL, Chien MS, Huang C. Yeast-expressed classical swine fever virus glycoprotein E2 induces a protective immune response. Veterinary microbiology. 2009; 139(3-4); 369-374. [PubMed: 19625145].
Gene Information
Gene Name E2
Gene Starting Position 373
Gene Ending Position 12069
Protein Information
Protein Name E2 protein
NCBI Protein GI 50403916
Protein pI 8.23
Protein Weight 6837.14
Protein Length 127
Protein Note Pestivirus envelope glycoprotein E2; pfam16329
Protein Sequence
>AAT76713.1 E2 protein, partial [Classical swine fever virus]
TTTWKEYTHDLQLNDGTVKATCVAGSFKVTALNVVSRRYLASLHKKALPTSVTFELLFDGTNP

Epitope Information
IEDB Linear Epitope