Mice immunized with rLm/iglC were protected against lethal challenge with F. tularensis LVS administered by the intranasal route, a route chosen to mimic airborne infection, and, most importantly, against aerosol challenge with the highly virulent Type A F. tularensis SchuS4 strain (Jia et al., 2009).
Jia et al., 2009: Jia Q, Lee BY, Clemens DL, Bowen RA, Horwitz MA. Recombinant attenuated Listeria monocytogenes vaccine expressing Francisella tularensis IglC induces protection in mice against aerosolized Type A F. tularensis. Vaccine. 2009; 27(8); 1216-1229. [PubMed: 19126421].
Similar to AAP58964.1 (Q7X3J5) IglC (23 kDa protein) from Francisella novicida (211 aa). BLAST Score = 405, Expect = e-112 Identities = 209/211 (99), Positives = 210/211 (99) Identical to FTT1712. It is part of the duplicated region 1374371..1408281 which is identical to 1767715..1801625
Protein Sequence
>YP_170309.1 intracellular growth locus subunit C [Francisella tularensis subsp. tularensis SCHU S4]
MIMSEMITRQQVTSGETIHVRTDPTACIGSHPNCRLFIDSLTIAGEKLDKNIVAIDGGEDVTKADSATAA
ASVIRLSITPGSINPTISITLGVLIKSNVRTKIEEKVSSILQASATDMKIKLGNSNKKQEYKTDEAWGIM
IDLSNLELYPISAKAFSISIEPTELMGVSKDGMRYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAA
A