The immunological protection of pVAX-PS, a DNA vaccine, was assessed in the tree shrews model. pVAX-PS was constructed by inserting the gene encoding the middle (pre-S2 plus S) envelope protein of HBV into a plasmid vector pVAX1. Results indicated that pVAX-PS immunization could induce remarkable humoral immune response and prevent the experimental tree shrews from infection of HBV (Zhou et al., 2003).
Zhou et al., 2003: Zhou FJ, Hu ZL, Dai JX, Chen RW, Shi K, Lin Y, Sun SH. Protection of tree shrews by pVAX-PS DNA vaccine against HBV infection. DNA and cell biology. 2003; 22(7); 475-478. [PubMed: 12932306].
>CAJ75787.1 preS2 middle surface protein [Hepatitis B virus]
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVL
QAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLF
ILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSS
WAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVY
I
