MPT63 (Rv1926c), a major secreted protein of Mycobacterium tuberculosis, is immunoreactive in antibody assays in humans and animals and provides protection as a combined DNA vaccine in mice (Mustafa, 2009).
References
Mustafa, 2009: Mustafa AS. Th1 cell reactivity and HLA-DR binding prediction for promiscuous recognition of MPT63 (Rv1926c), a major secreted protein of Mycobacterium tuberculosis. Scandinavian journal of immunology. 2009; 69(3); 213-222. [PubMed: 19281533].
Rv1926c, (MT1977, MTCY09F9.38), len: 159 aa. mpt63 (alternate gene name: mpb63), immunogenic protein (see citations below), identical to MPT63|MPB63 from Mycobacterium bovis (159 aa). Exported protein containing a N-terminal signal sequence: see notes below about proteomics.; mpb63
Protein Sequence
>NP_216442.1 immunogenic protein Mpt63 [Mycobacterium tuberculosis H37Rv]
MKLTTMIKTAVAVVAMAAIATFAAPVALAAYPITGKLGSELTMTDTVGQVVLGWKVSDLKSSTAVIPGYP
VAGQVWEATATVNAIRGSVTPAVSQFNARTADGINYRVLWQAAGPDTISGATIPQGEQSTGKIYFDVTGP
SPTIVAMNNGMEDLLIWEP
