Vaccination with an RASV synthesizing full-length PsaA induced high titers of anti-PsaA antibodies in both systemic (IgG in serum) and mucosal (IgA in vaginal washes, nasal washes, and lung homogenates) sites. BALB/c (haplotype H2(d)) or C57BL/6 (haplotype H2(b)) mice vaccinated either orally or intranasally exhibited a significant reduction in colonization of nasopharyngeal tissues after intranasal challenge with S. pneumoniae strains compared to controls, although protection was not observed with all challenge strains. None of the vaccine constructs provided protection against intraperitoneal challenge with S. pneumoniae strain WU2 (serotype 3) (Wang et al., 2010). The results of colonization experiment showed that compared with the control group, the PepO, PsaA, and combined immunization groups showed a significant reduction in the colonization of Streptococcus pneumoniae (CMCC31693 and CMCC31207) in the nasopharynx and lung (P<0.05).(Zhang et al., 2017)
Wang et al., 2010: Wang S, Li Y, Shi H, Scarpellini G, Torres-Escobar A, Roland KL, Curtiss R 3rd. Immune responses to recombinant pneumococcal PsaA antigen delivered by a live attenuated Salmonella vaccine. Infection and immunity. 2010; 78(7); 3258-3271. [PubMed: 20479086].
Zhang et al., 2017: Zhang J, Cui YL, Jiang YM. [Immunoprotective effect of combined pneumococcal endopeptidase O and pneumococcal surface adhesin A vaccines against Streptococcus pneumoniae infection]. Zhongguo dang dai er ke za zhi = Chinese journal of contemporary pediatrics. 2017; 19(5); 583-589. [PubMed: 28506354].
Gene Information
Gene Name
psaA
Protein Information
Protein Name
ABC transporter substrate-binding protein - manganese transport
Metal binding protein PsaA. These proteins have been shown to function as initial receptors in ABC transport of Mn2+ and as surface adhesins in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that...; cd01137
Protein Sequence
>AAL00298.1 ABC transporter substrate-binding protein - manganese transport [Streptococcus pneumoniae R6]
MKKLGTLLVLFLSAIILVACASGKKDTTSGQKLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYE
PLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHA
WLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKY
FSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTD
SIAEQGKEGDSYYSMMKYNLDKIAEGLAK
