VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


MSP1 from P. berghei

General Information
Protegen ID 641
Sequence Strain (Species/Organism) Plasmodium berghei
VO ID VO_0011225
Taxonomy ID 5821
Molecule Role Protective antigen
Molecule Role Annotation Mice vaccinated with recombinant rMSP1 (rPbMSP1), which was generated from Plasmodium berghei, in alum mounted significant protective immunity against challenge infection (P < 0.01). On day 121 after the booster, three out of ten mice immunized with rPbMSP1 in PBS survived parasite infection (P < 0.05) and eight out of ten mice vaccinated with r MSP1 in alum did (P < 0.01). Hence, immunization with MSP1 in alum obviously has conferred protective effects, which prevented death from P. berghei lethal infection in mice (P < 0.01) (Wan et al., 2007).
Related Vaccines(s) P. berghei MSP1 Protein Vaccine
References
Wan et al., 2007: Wan Omar A, Roslaini AM, Ngah ZU, Azahari AA, Zahedi M, Baharudin O. A recombinant 19 kDa Plasmodium berghei merozoite surface protein 1 formulated with alum induces protective immune response in mice. Tropical biomedicine. 2007; 24(1); 119-126. [PubMed: 17568385].
Gene Information
Gene Name MSP1 from P. berghei
Protein Information
Protein Name merozoite surface protein 1
NCBI Protein GI 1762646
Protein pI 4.24
Protein Weight 9906.72
Protein Length 184
Protein Sequence
>AAC47502.1 merozoite surface protein 1, partial [Plasmodium berghei]
SGQSSTEPASTGTPSSGEVSTGTSTGGASAGVTNTGAATTGTSTGGASAGVTNTGAATTGTTGTGAATTG
TTGAEAVTTGNTGAEVTQVQIVPTLTPEEKKKKMDGLYAQI

Epitope Information
IEDB Linear Epitope