VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


VP4

General Information
Protegen ID 660
Sequence Strain (Species/Organism) Human poliovirus 1
VO ID VO_0011244
Taxonomy ID 12080
Other Database IDs CDD:280403
Molecule Role Protective antigen
Molecule Role Annotation To examine the mechanism of immunity in vivo, researchers used poliovirus receptor-transgenic mice on a BALB/c (H-2d) background. Mice immunized with the vaccine strain were protected against a subsequent challenge with wild-type virus. Protection was observed when mice received primed B cells in the presence of a VP4-specific Th1 clone. Findings demonstrate that CD4+ T cells, specific for the internal poliovirus capsid protein, VP4, can provide effective help for a protective antibody response directed against surface capsid proteins (Mahon et al., 1995).
References
Mahon et al., 1995: Mahon BP, Katrak K, Nomoto A, Macadam AJ, Minor PD, Mills KH. Poliovirus-specific CD4+ Th1 clones with both cytotoxic and helper activity mediate protective humoral immunity against a lethal poliovirus infection in transgenic mice expressing the human poliovirus receptor. The Journal of experimental medicine. 1995; 181(4); 1285-1292. [PubMed: 7699320].
Gene Information
Gene Name VP4
Protein Information
Protein Name VP4
NCBI Protein GI 68532656
Protein pI 7.69
Protein Weight 7576.69
Protein Length 117
Protein Note Picornavirus coat protein (VP4); pfam02226
Protein Sequence
>BAE06026.1 VP4, partial [Human poliovirus 1]
MGAQVSSQKVGAHENSNRASGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN

Epitope Information
IEDB Linear Epitope