Study was designed to evaluate the immunogenicity and the protective efficacy of a divalent fusion DNA vaccine encoding both the Brucella abortus L7/L12 protein (ribosomal protein, rplL) and Omp16 protein (outer membrane lipoprotein). This divalent DNA vaccine induced a significant level of protection against challenge with the virulent B. abortus in BALB/c mice (Luo et al., 2006b).
Luo et al., 2006b: Luo D, Ni B, Li P, Shi W, Zhang S, Han Y, Mao L, He Y, Wu Y, Wang X. Protective immunity elicited by a divalent DNA vaccine encoding both the L7/L12 and Omp16 genes of Brucella abortus in BALB/c mice. Infection and immunity. 2006; 74(5); 2734-2741. [PubMed: 16622210].
present in two forms; L12 is normal, while L7 is aminoacylated at the N-terminal serine; the only multicopy ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two L12 dimers bind L10; critically important for translation efficiency and fidelity; stimulates GTPase activity of translation factors
Protein Sequence
>WP_002964371.1 MULTISPECIES: 50S ribosomal protein L7/L12 [Brucella]
MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDVVLADGGANKI
NVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAGAKVELK
