Protection from lethal viral infection has been achieved with passively administered monoclonal antibody specific for flavivirus glycoprotein NS1 (Pincus et al., 1992). Immunization of monkeys with yellow fever virus-specified nonstructural protein NS1 resulted in protection against fatal hepatitis as well as marked reduction in the magnitude of viremia after subcutaneous challenge with yellow fever virus (Schlesinger et al., 1986).
Pincus et al., 1992: Pincus S, Mason PW, Konishi E, Fonseca BA, Shope RE, Rice CM, Paoletti E. Recombinant vaccinia virus producing the prM and E proteins of yellow fever virus protects mice from lethal yellow fever encephalitis. Virology. 1992; 187(1); 290-297. [PubMed: 1736531].
Schlesinger et al., 1986: Schlesinger JJ, Brandriss MW, Cropp CB, Monath TP. Protection against yellow fever in monkeys by immunization with yellow fever virus nonstructural protein NS1. Journal of virology. 1986; 60(3); 1153-1155. [PubMed: 3783816].
Gene Information
Gene Name
NS1 (non-structural protein 1)
Protein Information
Protein Name
non-structural protein NS1
Protein Length
352
Protein Note
virion RNA mosquito-borne
Protein Sequence
>gi|27735290|ref|NP_776002.1| non-structural protein NS1 [Yellow fever virus]
DQGCAINFGKRELKCGDGIFIFRDSDDWLNKYSYYPEDPVKLASIVKASFEEGKCGLNSVDSLEHEMWRS
RADEINAIFEENEVDISVVVQDPKNVYQRGTHPFSRIRDGLQYGWKTWGKNLVFSPGRKNGSFIIDGKSR
KECPFSNRVWNSFQIEEFGTGVFTTRVYMDAVFEYTIDCDGSILGAAVNGKKSAHGSPTFWMGSHEVNGT
WMIHTLEALDYKECEWPLTHTIGTSVEESEMFMPRSIGGPVSSHNHIPGYKVQTNGPWMQVPLEVKREAC
PGTSVIIDGNCDGRGKSTRSTTDSGKVIPEWCCRSCTMPPVSFHGSDGCWYPMEIRPRKTHESHLVRSWV
TA
