VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


E1 glycoprotein

General Information
Protegen ID 727
Sequence Strain (Species/Organism) Venezuelan equine encephalitis virus
VO ID VO_0011267
Taxonomy ID 11036
Other Database IDs CDD:201874
Molecule Role Protective antigen
Molecule Role Annotation The monoclonal antibody against E1 glycoprotein protect outbred albino mice from lethal infection caused by the virulent strain Trd of the VEE virus (Agapov et al., 1994).
Additional Molecule Role Virmugen
Additional Molecule Role Annotation A VEE mutant with a PE2 cleavage signal mutation and a suppressor mutation in E1 is highly attenuated in mice and provides complete protection against challenge with wild type VEE (Davis et al., 1995).
Related Vaccines(s) VEE virus DNA vaccine VEEV IA/B parent encoding structural genes , VEE Virus PE2/E1 mutant vaccine
References
Agapov et al., 1994: Agapov EV, Razumov IA, Frolov IV, Kolykhalov AA, Netesov SV, Loktev VB. Localization of four antigenic sites involved in Venezuelan equine encephalomyelitis virus protection. Archives of virology. 1994; 139(1-2); 173-181. [PubMed: 7529989].
Davis et al., 1995: Davis NL, Brown KW, Greenwald GF, Zajac AJ, Zacny VL, Smith JF, Johnston RE. Attenuated mutants of Venezuelan equine encephalitis virus containing lethal mutations in the PE2 cleavage signal combined with a second-site suppressor mutation in E1. Virology. 1995; 212(1); 102-110. [PubMed: 7676619].
Gene Information
Gene Name E1 glycoprotein
Protein Information
Protein Name E1 glycoprotein
NCBI Protein GI 798795
Protein pI 7.54
Protein Weight 3856.25
Protein Length 114
Protein Note Alphavirus E1 glycoprotein; pfam01589
Protein Sequence
>AAA65907.1 E1 glycoprotein, partial [Venezuelan equine encephalitis virus]
WTWLTSLLGGSAVIIIIGLVLATIVAMYVLTNQKHN

Epitope Information
IEDB Linear Epitope