Immunisation of mice with DnaJ derived from Salmonella enterica subsp. enterica serovar Typhi str. CT18 was found to provide 70% protection against lethal challenge by S. Typhimurium indicating the possible use of DnaJ as vaccine candidate against typhoid (Sagi et al., 2006).
Sagi et al., 2006: Sagi SS, Paliwal P, Bansal A, Mishra C, Khan N, Mustoori SR, Ilavazhagan G, Sawhney RC, Banerjee PK. Studies on immunogenicity and protective efficacy of DnaJ of Salmonella Typhi against lethal infection by Salmonella Typhimurium in mice. Vaccine. 2006; 24(49-50); 7135-7141. [PubMed: 16887241].
chaperone Hsp40; co-chaperone with DnaK; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, dnaK-independent fashion
Protein Sequence
>NP_454623.1 DnaJ protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDAQKRAAYDQYG
HAAFEQGGMGGGFGGGFNGGADFSDIFGDVFGDIFGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIR
IPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVE
KSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALG
GEIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQKQLLKDLQES
FGGPTGEKNSPRSKSFFDGVKKFFDDLTR
