VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


protein G4

General Information
Protegen ID 761
Sequence Strain (Species/Organism) Trypanosoma cruzi
VO ID VO_0011298
Taxonomy ID 5693
Molecule Role Protective antigen
Molecule Role Annotation The vaccine efficacy of a putative candidate antigen against T. cruzi infection and disease in a mouse model. C57BL/6 mice vaccinated with a T. cruzi G4-encoding plasmid and cytokine (interleukin-12 and granulocyte-macrophage colony-stimulating factor) expression plasmids elicited a strong Th1-type antibody response dominated by immunoglobulin G2b (IgG2b)/IgG1 isotypes. The dominant IgG2b/IgG1 antibody response was maintained after a challenge infection and was associated with 90% control of the acute-phase tissue parasite burden and an almost undetectable level of tissue parasites during the chronic phase, as determined by a sensitive T. cruzi 18S rRNA gene-specific real-time PCR approach (Bhatia and Garg, 2008).
Related Vaccines(s) T. cruzi DNA Vaccine encoding G4 Protein , T. cruzi vaccine encoding TcG2 and TcG4 , T. cruzi Vaccine TcVac4
References
Bhatia and Garg, 2008: Bhatia V, Garg NJ. Previously unrecognized vaccine candidates control Trypanosoma cruzi infection and immunopathology in mice. Clinical and vaccine immunology : CVI. 2008; 15(8); 1158-1164. [PubMed: 18550728].
Gene Information
Gene Name protein G4
Protein Information
Protein Name protein G4
NCBI Protein GI 52424038
Protein pI 10.06
Protein Weight 10324.13
Protein Length 137
Protein Sequence
>AAU47268.1 protein G4 [Trypanosoma cruzi]
MSAKAPPKTLHQVRNVAYIFAAWAGLQKGFAEKSANDKMWVEHQRRLRQENAKRQHAAHALEELKQDEEL
ERSIPTIVPKELHELVKALEK

Epitope Information
IEDB Linear Epitope