LolC was evaluated as an antigen for a vaccine candidate against B. pseudomallei infection. Nonmembrane regions of the B. pseudomallei protein was expressed and purified from Escherichia coli and then evaluated as a vaccine candidate in an established mouse model of B. pseudomallei infection. When delivered with the monophosphoryl lipid A-trehalose dicorynomycolate adjuvant, the protein stimulated antigen-specific humoral and cellular immune responses. Immunization with the LolC protein domain afforded significant protection against a subsequent challenge with B. pseudomallei. LolC provided a greater level of protection when it was administered with immune-stimulating complexes complexed with CpG oligodeoxynucleotide 10103. Immunization with LolC also protected against a subsequent challenge with a heterologous strain of B. pseudomallei, demonstrating the potential utility of this protein as a vaccine antigen for melioidosis (Harland et al., 2007).
Harland et al., 2007: Harland DN, Chu K, Haque A, Nelson M, Walker NJ, Sarkar-Tyson M, Atkins TP, Moore B, Brown KA, Bancroft G, Titball RW, Atkins HS. Identification of a LolC homologue in Burkholderia pseudomallei, a novel protective antigen for melioidosis. Infection and immunity. 2007; 75(8); 4173-4180. [PubMed: 17517877].
Similar to Escherichia coli lipoprotein releasing system transmembrane protein LolE SWALL:LOLE_ECOLI (SWALL:P75958) (413 aa) fasta scores: E(): 1.3e-42, 34.54% id in 414 aa, and to Ralstonia solanacearum probable lipoprotein releasing system transmembrane rsc1117 or rs05757 SWALL:Q8Y0C7 (EMBL: AL646062) (416 aa) fasta scores: E(): 1.4e-112, 71.46% id in 417 aa
Protein Sequence
>YP_108873.1 lipoprotein releasing system transmembrane protein [Burkholderia pseudomallei K96243]
MKLPYEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLSVLAHVE
IFSPTGSMPDWQLTAKEARLNRSVIGAAPYVDAQALLTRQDAVSGVMLRGVEPSLEPQVSDIGKDMKAGA
LTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGMMPRLKQFTVVGIFESGHYEYDSTLAMI
DIQDAQALFRLPAPTGVRLRLTDMQKAPQVARELAHTLSGDLYIRDWTQQNKTWFSAVQIEKRMMFIILT
LIIAVAAFNLVSSLVMTVTNKQADIAILRTLGAQPGSIMKIFVVQGVTIGFVGTATGVALGCLIAWSIPW
LIPMIEHAFGVQFLPPSVYFISELPSELVAGDVIKIGVIAFALSALATLYPSWRGAKVRPAEALRYE
