VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


6K

General Information
Protegen ID 775
Sequence Strain (Species/Organism) Western equine encephalomyelitis virus
VO ID VO_0011307
Taxonomy ID 11039
Other Database IDs CDD:279870
Molecule Role Protective antigen
Molecule Role Annotation DNA vaccines encoding different portions of the structural proteins of western equine encephalitis virus were tested for the efficacy of their protection in a 100% lethal mouse model of the virus. The 6K-E1 structural protein encoded by the DNA vaccine conferred complete protection against challenge with the homologous strain and limited protection against challenge with a heterologous strain (Gauci et al., 2010).

Note: The 6K protein is part of the 6K-E1 structural protein
Related Vaccines(s) WEEV DNA Vaccine encoding 6K-E1 Protein
References
Gauci et al., 2010: Gauci PJ, Wu JQ, Rayner GA, Barabé ND, Nagata LP, Proll DF. Identification of Western equine encephalitis virus structural proteins that confer protection after DNA vaccination. Clinical and vaccine immunology : CVI. 2010; 17(1); 176-179. [PubMed: 19923571].
Gene Information
Gene Name 6K
Protein Information
Protein Name 6K protein
NCBI Protein GI 29611993
Protein pI 7.08
Protein Weight 6303.88
Protein Length 117
Protein Note Alphavirus E1 glycoprotein; pfam01589
Protein Sequence 
>NP_818941.1 6K protein [Western equine encephalitis virus]
ETFGETLNHLWFNNQPFLWAQLCIPLAALVILFRCFSCCMPFLLVAGVCLGKVDA
Epitope Information
IEDB Linear Epitope