VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (28)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (47)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


NAP

General Information
Protegen ID 806
Sequence Strain (Species/Organism) Helicobacter pylori
VO ID VO_0011337
Taxonomy ID 210
Other Database IDs CDD:223854
CDD:153102
Molecule Role Protective antigen
Molecule Role Annotation A study shows that vaccination of mice with HP-NAP (H. pylori NAP) induces protection against H. pylori challenge, and that the majority of infected patients produce antibodies specific for HP-NAP, suggesting an important role of this factor in immunity (Satin et al., 2000).
In this study, a multivalent epitope-based vaccine named CWAE against H. pylori urease, neutrophil-activating protein (NAP), heat shock protein 60 (HSP60) and H. pylori adhesin A (HpaA) was constructed based on mucosal adjuvant cholera toxin B subunit (CTB), Th1-type adjuvant NAP, multiple copies of selected B and Th cell epitopes and also the epitope-rich regions of urease B subunit The protection of CWAE was associated with higher levels of mixed CD4+ T cell (Th cell) response, IgG, and secretory IgA (sIgA) antibodies to H. pylori (Guo et al., 2017).
Related Vaccines(s) H. pylori NAP protein vaccine
References
Guo et al., 2017: Guo L, Yang H, Tang F, Yin R, Liu H, Gong X, Wei J, Zhang Y, Xu G, Liu K. Oral Immunization with a Multivalent Epitope-Based Vaccine, Based on NAP, Urease, HSP60, and HpaA, Provides Therapeutic Effect on <i>H. pylori</i> Infection in Mongolian gerbils. Frontiers in cellular and infection microbiology. 2017; 7; 349. [PubMed: 28824883].
Satin et al., 2000: Satin B, Del Giudice G, Della Bianca V, Dusi S, Laudanna C, Tonello F, Kelleher D, Rappuoli R, Montecucco C, Rossi F. The neutrophil-activating protein (HP-NAP) of Helicobacter pylori is a protective antigen and a major virulence factor. The Journal of experimental medicine. 2000; 191(9); 1467-1476. [PubMed: 10790422].
Gene Information
Gene Name NAP
Protein Information
Protein Name neutrophil-activating protein
NCBI Protein GI 8777456
3D structure: PDB ID 1JI4
Protein pI 6.34
Protein Weight 16292.55
Protein Length 221
Protein Note DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism, Defense mechanisms]; COG0783
Protein Sequence
>BAA96880.1 neutrophil-activating protein, partial [Helicobacter pylori]
MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEGFADMFDDLAERIAQLGHHPLVTLS
EALKLTRVKEETKTSFHSKDIFKEILEDYKHLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQ
AHLA

Epitope Information
IEDB Linear Epitope