VIOLIN Logo
VO Banner
Search: for Help
Protegen Home
Introduction
Statistics
News and Updates
Protegen Query
Protegen BLAST
Selected Bacteria
Brucella spp. (26)
B. anthracis (14)
E. coli (40)
M. tuberculosis (26)
N. meningitidis (18)
Selected Viruses
Ebola virus (19)
HIV (41)
Influenza virus (50)
Selected Parasites
Plasmodium (33)
Data Submission
Data Exchange
Data Download
Documentation
FAQs
Disclaimer
Contact Us
UMMS Logo


FbpD

General Information
Protegen ID 814
Sequence Strain (Species/Organism) Mycobacterium bovis BCG str. Tokyo 172
VO ID VO_0012366
Taxonomy ID 561275
Molecule Role Protective antigen
Molecule Role Annotation Intravenous vaccination with recombinant bacteria carrying expression plasmid for MPB/MPT51 in BALB/c mice elicited significant protective responses, comparable to those evoked by a live Mycobacterium bovis BCG vaccine (Miki et al., 2004).
References
Miki et al., 2004: Miki K, Nagata T, Tanaka T, Kim YH, Uchijima M, Ohara N, Nakamura S, Okada M, Koide Y. Induction of protective cellular immunity against Mycobacterium tuberculosis by recombinant attenuated self-destructing Listeria monocytogenes strains harboring eukaryotic expression plasmids for antigen 85 complex and MPB/MPT51. Infection and immunity. 2004; 72(4); 2014-2021. [PubMed: 15039321].
Gene Information
Gene Name FbpD
NCBI Gene ID 7562680
Genbank Accession AP010918
Locus Tag JTY_3867
Gene Starting Position 4234158
Gene Ending Position 4235057
DNA Sequence
>NC_012207.1:4234158-4235057 Mycobacterium bovis BCG str. Tokyo 172 DNA, complete genome
CTTAGCGGATCGCACCGACGATATCGCCCGACATAGCGCCCAGCTGGGGCGCCCACGAGCCCCAGCCGTT
GTCACCGCTGGCTGGGAAGTCGAAGTGTCCGTTGTGCCCGCCGACGCTGCGATACTGGTTGTAGAACATG
CGGCTGTTACCCATCGCCTCGGCGGCTTGGCCGATCATGGCGGCGGGATCGCTGGCTCCCGGGTTGGTCG
GGCTCCACACCCACACCCGGGTGTTGTTTTGCGCCAGCAGGCTGGCATGCACCCACGGGTCGTGCCACTT
CCACCGACCCAGCTGTGGTGCTCCCCACATTCCGTTGGTGTCCACACCGCCGAATTGCTGCATGCCCGCC
GCGATCGCACCGTTGGTGGTGGTGTTCGACGGGTACAAAAAGCCCGACATCGAGCCAGCGAAGCCGAAGC
GGTCGGGGTGGAAGGCCGCCAGCGCCATCGCCCCGTAACCGCCCTGAGCGGCGCCAACGGCCGCATGGCC
ACCGGGGGCCAAGCCCCGGTTAGCGGCCAGCCAGTCGGGCAGCTCAGCGGACAAGAAGGTGTCCCACTGC
TTGCTGCCATCCTGCTCCCAGTTGGTGTACATGCTGTACGCACCACCGGCCGGTGCCACCACCGAAATCC
CCTTGCCCGCCAACGTGTTCATCGCGTTACCCGCGGTGACCCAGTTACTGACATCCGGGCCGGCGTTGAA
GGCGTCCAGCAGATACACCGCGTGCGGCCCACCGGCTAGGAAGGCCACCGGGATGTCCCGGCCCATCGAG
GGCGACGGCACCATCAGGTTCTCGTATGGGGCGGCCTTGGCGGTGGGTTCCGCGGCTACCGCGACACCGC
CCAACCCGAATGACAGTGCGGCAATCCAGAGCGCCCGCAGCAGCGCCGACCGACCCTTCA

Protein Information
Protein Name MPT51/MPB51 antigen protein
NCBI Protein GI 224992215
Protein Accession YP_002646905
3D structure: PDB ID 1R88
Protein pI 6.63
Protein Weight 29500.66
Protein Length 299
Protein Sequence
>YP_002646905.1 MPT51/MPB51 antigen protein [Mycobacterium bovis BCG str. Tokyo 172]
MKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNA
GPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHA
AVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWH
DPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGW
GSWAPQLGAMSGDIVGAIR

Vaxign Prediction
Localization(Probability) Extracellular
(Prob.=1)
Adhesin Probability 0.747
Trans-membrane Helices 1
Detailed Vaxign Results Vaxign Results
Epitope Information
IEDB Linear Epitope