A selection of previously identified protective Mycobacterium tuberculosis DNA vaccines were re-formulated as proteins and administered with a Th1-inducing adjuvant to help stimulate the relevant immune responses necessary for protection. One candidate (Rv1806-1807) induced protection in the guinea pig aerosol infection model 30 days post-challenge on the basis of reducing the bacterial burden of M. tuberculosis in the lungs (Vipond et al., 2006).
Vipond et al., 2006: Vipond J, Clark SO, Hatch GJ, Vipond R, Marie Agger E, Tree JA, Williams A, Marsh PD. Re-formulation of selected DNA vaccine candidates and their evaluation as protein vaccines using a guinea pig aerosol infection model of tuberculosis. Tuberculosis (Edinburgh, Scotland). 2006 May-Jul; 86(3-4); 218-24. [PubMed: 16520093].
Rv1806, (MTV049.28), len: 99 aa. Member of the Mycobacterium tuberculosis PE family of gly-, ala-rich proteins (see citation below), most similar to Rv1788|MTV049.10|AL022021 (99 aa), FASTA scores: opt: 334, E(): 4.7 e-15, (59.8% identity in 97 aa overlap). TBparse score is 0.932.
Protein Sequence
>YP_177843.1 PE family protein PE20 [Mycobacterium tuberculosis H37Rv]
MAFVLVCPDALAIAAGQLRHVGSVIAARNAVAAPATAELAPAAADEVSALTATQFNFHAAMYQAVGAQAI
AMNEAFVAMLGASADSYAATEAANIIAVS
