VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

YopE

Gene Name YopE
Sequence Strain (Species/Organism) Yersinia pestis KIM 10
NCBI Gene ID 1149129
NCBI Protein GI 31795304
Locus Tag YKCD1p59
Genbank Accession AF053946
Protein Accession NP_857762
Taxonomy ID 187410
Plasmid No pCD1
Gene Starting Position 44185
Gene Ending Position 44844
Gene Strand (Orientation) -
Protein Name secreted effector protein
Protein pI 6.77
Protein Weight 21994.2
Protein Length 219
DNA Sequence
>gi|31795262:44185-44844 Yersinia pestis KIM plasmid pCD1, complete sequence
ATCACATCAATGACAGTAATTTCTGCATCTGTTGCGCCAGCCCTTTGATCTCATTTGCTGCCTGCGTTAG
ATCAACGCCACTGGCGACGTACGCGCTGGCCGCCCCACCAATAGTTCCCCACTGCGAGAAGGGAATACCA
CAAACAGGCGTGTTTAAGATGGCACTGGCCTCAGCTTGCAATTCCCCACCACAAAACTGCATCAGCCCTT
GGCATTGAGTGATACTGCCACGAAGAGGGCCGCTGCCCGTAGCGAACTGATCATGATTTTTCTGCAGCAT
CTCTGCATCCAAGCTATTCAACTGCTGCATGTATTTTGGCAGCGTCTCAGCAGCAAGTTGCTTGATACTG
TCACTGAAAGACGTAGGACTTGGCATTTGTGCAGGTGTGGGTGCTGGTGTCACCACCGGTTTATGGCTCC
CCTCCGAGAACATGCGTTGGATAAACCCAATCACAGAGTGGGCCACTGATGATAACCTCTCAATGATACG
GCTGGCTAAGCTGGAACCCTGAGGGCTTTCAGTGCGCCCGGCCAGATTGTTTGCATATTGATCACTTGTT
TGCTGTGAGACTGAGCGCCCAGACATTTCTCCTACGCTGCTAGATCCTGACACAGATGTCGGCAGGGGCA
GTGATGTAGAAATAAATGATGATATTTTCA
Protein Sequence
>gi|31795304|ref|NP_857762.1| secreted effector protein [Yersinia pestis KIM]
MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQTSDQYANNLAGRTESPQGSSLASRIIERLSSVAHSV
IGFIQRMFSEGSHKPVVTPAPTPAQMPSPTSFSDSIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGS
GPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQ
QMQKLLSLM
Molecule Role Protective antigen
Molecule Role Annotation Immunizing mice with a single peptide, YopE(69-77), suffices to confer significant protection from lethal pulmonary challenge (Lin et al., 2011).
Related Vaccines(s) YopE(67-77) Protein Vaccine
References