VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Defb3

Gene Name Defb3
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 27358
NCBI Protein GI 7304997
Genbank Accession AC113099
Protein Accession NP_038784
Taxonomy ID 10090
Chromosome No 8
Gene Starting Position 19293360
Gene Ending Position 19295338
Gene Strand (Orientation) +
Protein Name defensin beta 3
Protein pI 11.07
Protein Weight 6827.63
Protein Length 63
Protein Note Also known as BD-3; MGC129397
DNA Sequence
>gi|372099102:19293360-19295338 Mus musculus strain C57BL/6J chromosome 8, GRCm38 C57BL/6J
CCAGGCTTCAGTCATGAGGATCCATTACCTTCTGTTTGCATTTCTCCTGGTGCTGCTGTCTCCACCTGCA
GGTGAGTCAGGGGAGTAGGGTCATCCCACACTGATAGGAGAGACAACACCCTACATCAGGTGTGTGTGTA
TGTGTGTGTGTCTGTGTGCCTATGTATCTCTGTGTTTGTCTCGGAGTCTCCCTCTCTATGTATCTTTCTG
TTTCTCTGTGTTTGCATCTCTCTCTGTGTCTTTGTGTTTCTGTGTCTCTATGTTTGTGTCTGTCTGTCTG
TCTATCTCTCTCTCTTTCTGTGTATGTGTGCATGTGTATACCTTTATGTCCCTTAATCTTCGTGTGTTGG
TTTGTCTCCCTCTCATTTTATGTGTGTGTGTTCCTCTGCGCATGCATCTGTCTTTCTGTCTCTATGTGTA
TATGTCTGTCTTTCTGTGTATAAGTCCATATCTATGTTTCTGTCTGTGTCTTTTTCTCCTTTTTACATAT
ACCCTCCTTACTTTTGCATTTTTCTTTCTTTCTTCTAAGCATTTTAGAAAATGTGTATTGTTGACTACTA
ACACAAACCAAGGACTCTTTCTTTTTCCCTTGAAGGAGTCTAAGGTAGACACATGCTCTGCTCATCTGCA
GCAATTGACTTCCATTTCCTAACTCCTGATGCTAAGCTTAAGATTATCAAATGAGTGTCTTATAGGTAGC
TTAAAAATAGTAACATGAAGAATGTTTGATTCTTACATGAACAGAAAGGTATTAATTTAGAAATCTTTAC
ATATAAGGAGTAGAGTCTCTGCTTACTCTAGAGAACTCCTCAGAATAACCAGCCTAGCCTGTTTGAGAAC
TTCTGCTCCCCTTAGCCCCATGGAATACCCCTGAGCACACAGTGTCTACAGGGTTAATGAGGTTCATAGC
ACAGGGGAGGCTATTAAATCCTGTCTCCCAAACTTTTGCTTAAGTGTATTTAGTGGAAAAAATTTATTTT
CTGTAAATTATGTGTATATGTATTGATTTGTATATGGGTATGTGCCAAGTAGTACAGTACTCACAGAGGT
CATAAAAGGAAATCATATCTCTCAGAGATGGAGTTATTTATAGGCACATATGGCCTGCCTGATATGGTAC
TAGGAACTTATCTCAGGTCTTCAGCAGGAGCAGTATGCACTCCTACAGGCTGAGCCATCTTTCCAGGCTC
CAAGCTGTGTTTCATACTTGACTTTAGACAAACAGAATAATGGGGTTAGACAACTCATGTGAGGGAGCTA
AAACAAGTAATGAGTTGGAGAGGAATTGATGAACACATCTTAGGCCAACCTGTGGCCTCTATATGTGTGT
GCACACATGCACATTCATGTGCACAGTCACACTCAGTGTCTGTTTCACATGCTAGAAGTAGGGGCTTGTG
TGTGGAGAAGCAAAGGCAGGGCTGCTAAGAAGTAGCTAGGGAGTCACACAAAATCTTTCCTGAGCTACTG
CATGCTGGCTTTGAATACTCCAATCAGTCAGGGGTTGAGCAGATCCTTCAACATTTGGGTCCTAGGAATA
CCAGCACCTCCTCTACACTGCAACTGTGCCTGTCTCGAACAAGAATTGGATTCAGCCCTGCTAAAACAGA
CATTACTGTTTGGGCAGAACAATCTGCTGGGATCTACTTATCATAAGAACACATTGGTATGTATTTCTGA
CCTACCACTTTCAATTTTAATGTATGGTTTTTCTTACTTATCTTTCAGCTTTTAGCAAAAAAATCAACAA
TCCAGTAAGTTGTTTGAGGAAAGGAGGCAGATGCTGGAATCGGTGCATTGGCAACACTCGTCAGATTGGC
AGTTGTGGAGTTCCTTTCCTCAAATGCTGCAAGAGAAAATAGAGAAGACCAAGATCCCGTTAAACAAAGA
AAACACCAGAATTTGCTCCTCCATGAAGATGGACAAATCTTAAACCAAATTAATATTCCTTGATTAAATG
CAAACAAGTGCTCCCTAGC
Protein Sequence
>gi|7304997|ref|NP_038784.1| beta-defensin 3 precursor [Mus musculus]
MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK
Molecule Role Vaximmutor
Related Vaccines(s) Mycobacterium tuberculosis sigE mutant vaccine
References