VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Glycoprotein

Gene Name Glycoprotein
Sequence Strain (Species/Organism) Viral hemorrhagic septicemia virus Danish isolate DK-3592B
NCBI Protein GI 299444
Genbank Accession Y18263
Protein Accession NP_049548
Other Database IDs CDD:279337
Taxonomy ID 11287
Gene Starting Position 2958
Gene Ending Position 4532
Gene Strand (Orientation) ?
Protein Name envelope glycoprotein
Protein pI 7.14
Protein Weight 54010.72
Protein Length 647
Protein Note G protein
DNA Sequence
>gi|9632550:2958-4532 Viral hemorrhagic septicemia virus Fil3, complete genome
CATGGAATGGAACACTTTTTTCTTGGTCATCTTGATCATCATCATAAAGAGCACCACACCACAGATCACT
CAACGACCTCCGGTCGAAAACATCTCGACGTACCATGCAGATTGGGACACTCCGCTATACACTCATCCCT
CCAACTGCAGGGACGATTCCTTTGTCCCGATTCGACCAGCTCAACTCAGGTGTCCTCATGAATTTGAAGA
CATAAACAAGGGACTGGTCTCCGTCCCAACCAAGATCATCCATCTCCCGCTATCAGTCACCAGCGTCTCC
GCAGTCGCGAGTGGCCACTACCTGCACAGAGTGACTTATCGAGTCACCTGTTCGACCAGCTTCTTTGGAG
GGCAAACCATTGAAAAGACCATCTTAGAGGCGAAACTGTCTCGTCAGGAGGCCACAGACGAGGCAAGCAA
GGATCACGAGTACCCGTTCTTCCCTGAACCCTCCTGCATCTGGATGAAAAACAATGTCCATAAGGACATA
ACTCACTATTACAAGACCCCAAAAACAGTATCGGTGGATCTCTACAGCAGGAAATTTCTCAACCCTGATT
TCATAGAGGGGGTTTGCACAACCTCGCCCTGTCAAACTCATTGGCAGGGAGTCTATTGGGTCGGTGCCAC
ACCCAAAGCCCATTGCCCCACGTCGGAAACACTAGAAGGACACCTGTTCACCAGGACCCATGATCACAGG
GTGGTCAAGGCAATTGTGGCAGGCCATCATCCCTGGGGACTCACAATGGCATGCACAGTGACATTCTGCG
GGGCAGAATGGATCAAGACTGACCTGGGAGACCTGATCCAGGTAACAGGACCGGGGGGCACGGGGAAACT
GACTCCAAAGAAGTGTGTCAATGCTGATGTCCAGATGAGGGGGGCAACAGATGACTTTTCTTATCTCAAC
CATCTCATCACCAACATGGCTCAAAGAACCGAGTGCCTAGATGCCCATAGTGATATCACCGCTTCTGGGA
AAATATCCTCATTTCTCCTCTCAAAGTTTCGTCCCAGCCACCCTGGACCCGGCAAGGCACACTATCTTCT
CAACGGTCAAATCATGCGAGGTGACTGTGACTATGAGGCAGTAGTCAGCATCAACTACAACAGCGCTCAA
TACAAGACAGTGAACAACACATGGAAATCATGGAAACGGGTAGACAACAACACAGACGGGTACGATGGGA
TGATATTTGGGGACAAATTGATCATCCCGGACATCGAGAAGTATCAGAGTGTCTATGACAGTGGAATGCT
CGTTCAAAGAAACCTTGTGGAAGTCCCTCATCTGAGCATTGTGTTTGTCTCCAACACATCTGATCTTTCC
ACTAATCACATCCACACCAACCTAATCCCTTCGGATTGGTCATTCCACTGGAGTATTTGGCCCTCATTAT
CTGGGATGGGGGTTGTGGGAGGGGCCTTCCTTCTACTGGTACTCTGCTGTTGCTGCAAGGCGTCCCCTCC
CATTCCAAATTACGGGATTCCGATGCAGCAGTTCTCCAGAAGTCAGACGGTCTGAGCACACCTGTCCGAA
TGACCACAATTCCTCTATTAGGTAGATAGAAAAAA
Protein Sequence
>AAB26115.1 envelope glycoprotein, G protein [viral haemorrhagic septicaemia virus VHSV, Danish isolate DK-3592B, Peptide, 507 aa]
MEWNTFFLVILIIIIKSTTPQITQRPPVENISTYHADWDTPLYTHPSNCRDDSFVPIRPAQLRCPHEFED
INKGLVSVPTKIIHLPLSVTSVSAVASGHYLHRVTYRVTCSTSFFGGQTIEKTILEAKLSRQEATDEASK
DHEYPFFPEPSCIWMKNNVHKDITHYYKTPKTVSVDLYSRKFLNPDFIEGVCTTSPCQTHWQGVYWVGAT
PKAHCPTSETLEGHLFTRTHDHRVVKAIVAGHHPWGLTMACTVTFCGAEWIKTDLGDLIQVTGPGGTGKL
TPKKCVNADVQMRGATDDFSYLNHLITNMAQRTECLDAHSDITASGKISSFLLSKFRPSHPGPGKAHYLL
NGQIMRGDCDYEAVVSINYNSAQYKTVNNTWKSWKRVDNNTDGYDGMIFGDKLIIPDIEKYQSVYDSGML
VQRNLVEVPHLSTVFVSNTSDLSTNHIHTNLIPSDWSFHWSIWPSLSGMGVVGGAFLLLVLCCCCKASPP
IPNYGIPMQQFSRSQTV

Molecule Role Protective antigen
Related Vaccines(s) VHSV DNA vaccine pCMV-vhsG encoding glycoprotein G , VHSV DNA vaccine pCMV-vhsN encoding nucleocapsid protein N and glycoprotein G , VHSV DNA vaccine pVHS-G encoding glycoproteins
References