VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PA63-LAMP1

Gene Name PA63-LAMP1
Sequence Strain (Species/Organism) synthetic construct derived from Bacillus anthracis
NCBI Protein GI 193873761
Other Database IDs CDD:281492
CDD:213052
Taxonomy ID 32630
Gene Strand (Orientation) ?
Protein Name PA63-LAMP1
Protein pI 6.22
Protein Weight 64720.28
Protein Length 659
Protein Note Clostridial binary toxin B/anthrax toxin PA; pfam03495
Protein Sequence
>ACF23538.1 PA63-LAMP1 [synthetic construct]
MPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTG
RIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHA
SFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTT
SLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD
TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDM
TLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILI
RDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKISSGYIVEIEDTEGLKEVINDRYD
MLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKG
YEIGGLNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI

Molecule Role Protective antigen
Related Vaccines(s) B. anthracis DNA vaccine pLAMP1-PA63
References