VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

D8L

Gene Name D8L
Sequence Strain (Species/Organism) Vaccinia virus
NCBI Gene ID 3707569
NCBI Protein GI 66275910
Locus Tag VACWR113
Genbank Accession DQ121394
Protein Accession YP_232995
Taxonomy ID 10245
Gene Starting Position 103060
Gene Ending Position 103974
Gene Strand (Orientation) -
Protein Name IMV membrane protein
Protein pI 8.9
Protein Weight 34254.27
Protein Length 304
Protein Note similar to VACCP-D8L; binds cell surface chondroitin; may effect viral entry
DNA Sequence
>NC_006998.1:103060-103974 Vaccinia virus, complete genome
TCTAGTTTTGTTTTTCTCGCGAATATCGTCGACTCATAAAAAAGAGAATAGCGGTAAGTATAAACACGAA
TACTATGGCAATAATTGCGAATGTTTTATTCTCTTCGATATATTTTTGATAATATGAAAAACATGTCTCT
CTCAAATCGGACAACCATCTCATAAAATAGTTCTCGCGCGCTGGAGAGGTAGTTGCTGCTCGTATAATCT
CCCCAGAATAATATACTTGCGTGTCGTCGTTCAATTTATACGGATTTCTATAGTTCTCTGTTATATAATG
CGGTTTTCCATCATGATTAGACGACGACAATAGTGTTCTGAATTTAGATAGTTGATCAGAATGAATGTTT
ATTGGCGTTGGAAAAATTATCCATACAGCGTCTGCAGAGTGGTTGATAGTTGTTCCTAGATATGTAAAAT
AATCCAACTTACTAGGCAGCAAATTGTCTAGATAAAATACTGAATCAAACGGTGCAGACGTATTGGCGGA
TCTAATGGAATCCAATTGATTAACTATCTTTTGAAAATATACATTTTTATGATCCAATACTTGTAAGAAT
ATAGAAATAATGATAAGTCCATCATCGTGTTTTTTTGCCTCTTCATAAGAACTATATTTTTTCTTATTCC
AATGAACAAGATTAATCTCTCCAGAGTATTTGTACACATCTATCAAGTGATTGGATCCATAATCGTCTTC
CTTTCCCCAATATATATGTAGTGATGATAACACATATTCATTGGGGAGAAACCCTCCACTTATATATCCT
CCTTTAAAATTAATCCTTACTAGTTTTCCAGTGTTCTGGATAGTGGTTGGTTTCGACTCATTATAATGTA
TGTCTAACGGCTTCAATCGCGCGTTAGAAATTGCTTTTTTAGTTTCTATATTAATAGGAGATAGTTGTTG
CGGCA

Protein Sequence
>YP_232995.1 IMV membrane protein [Vaccinia virus]
MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLHIYW
GKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVLDHKNVYFQKIVNQLDS
IRSANTSAPFDSVFYLDNLLPSKLDYFTYLGTTINHSADAVWIIFPTPINIHSDQLSKFRTLLSSSNHDG
KPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPARENYFMRWLSDLRETCFSYYQKYIEENKTFAIIA
IVFVFILTAILFFMSRRYSREKQN

Molecule Role Protective antigen
Related Vaccines(s) Vaccinia virus DNA vaccine tPA-D8L , Vaccinia virus DNA vaccine wtD8L
References