VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

fbpA

Gene Name fbpA
Sequence Strain (Species/Organism) Mycobacterium marinum
NCBI Protein GI 13431282
Other Database IDs CDD:304388
Taxonomy ID 1781
Gene Strand (Orientation) ?
Protein Name Diacylglycerol acyltransferase/mycolyltransferase Ag85A
Protein pI 7.43
Protein Weight 18276.89
Protein Length 422
Protein Note DGAT; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex A; Fibronectin-binding protein A; 85A; Ag85A; Fbps A
Protein Sequence
>sp|Q9KH57.1|A85A_MYCMR RecName: Full=Diacylglycerol acyltransferase/mycolyltransferase Ag85A; Short=DGAT; AltName: Full=Acyl-CoA:diacylglycerol acyltransferase; AltName: Full=Antigen 85 complex A; Short=85A; Short=Ag85A; AltName: Full=Fibronectin-binding protein A; Short=Fbps A
PTGSGVVGLSMAGSSALILAAYHPDQFVYSGSLSALLDPSQGMGPSLIGLAMGDAGGYKASDMWGPKDDP
AWARNDPMLQVGKLVANNTRIWVYCGNGKPSDLGGDNLPAKFLEGFVRTSNMKFQAAYNAAGGHNAVWN

Molecule Role Protective antigen
Related Vaccines(s) M. marinum pCMV-85A
References