VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

MAGE-1

Gene Name MAGE-1
Sequence Strain (Species/Organism) Homo sapiens
NCBI Protein GI 416115
Other Database IDs CDD:289225
CDD:279759
Taxonomy ID 9606
Gene Strand (Orientation) ?
Protein Name MAGE-1
Protein pI 4.54
Protein Weight 32600.49
Protein Length 349
Protein Note Melanoma associated antigen family N terminal; pfam12440
Protein Sequence
>AAA03229.1 MAGE-1 [Homo sapiens]
MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINF
TRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCF
PEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAP
EEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVL
EYVIKVSARVRFFFPSLREAALREEEEGV

Molecule Role Protective antigen
Related Vaccines(s) Melanoma DNA vaccine pN4a-MAGE-1-GM , Melanoma DNA vaccine pNL3-MAGE-1-GM
References