VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

L1R

Gene Name L1R
Sequence Strain (Species/Organism) Vaccinia virus strain Connaught
NCBI Protein GI 7546898
Other Database IDs CDD:280581
Taxonomy ID 10245
Gene Strand (Orientation) ?
Protein Name L1R
Protein pI 7.76
Protein Weight 26150.63
Protein Length 288
Protein Note intracellular mature virion (IMV) immunogen, neutralizing antibodies
Protein Sequence
>AAF63732.1 L1R [Vaccinia virus]
MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLS
AATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAP
GSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTGVQFYMIVIGVIILAALFMYYAKRMLFT
STNDKIKLILANKENVHWTTYMDTFFRTSPMVIATTDMQN

Molecule Role Protective antigen
Related Vaccines(s) Vaccinia virus DNA vaccine 4pox
References