VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

A33R

Gene Name A33R
Sequence Strain (Species/Organism) Vaccinia virus strain Connaught
NCBI Protein GI 7546900
Other Database IDs CDD:222979
Taxonomy ID 10245
Gene Strand (Orientation) ?
Protein Name A33R
Protein pI 5.69
Protein Weight 19732.49
Protein Length 223
Protein Note extracellular enveloped virion (EEV) immunogen, nonneutralizing antibodies
Protein Sequence
>AAF63733.1 A33R [Vaccinia virus]
MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAI
TDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVL
ITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Molecule Role Protective antigen
Related Vaccines(s) Vaccinia virus DNA vaccine 4pox
References