VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

B5R

Gene Name B5R
Sequence Strain (Species/Organism) Vaccinia virus strain Connaught
NCBI Protein GI 29029576
Other Database IDs CDD:165263
CDD:278512
CDD:153056
Taxonomy ID 10245
Gene Strand (Orientation) ?
Protein Name B5R
Protein pI 4.58
Protein Weight 32956.01
Protein Length 356
Protein Note EEV membrane glycoprotein; Provisional
Protein Sequence
>AAN78219.1 B5R [Vaccinia virus]
MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYEN
PCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSC
QPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLS
CKSGFILTGSPSSTCIDGKWNPILPTCVRSNKEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHI
IIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

Molecule Role Protective antigen
Related Vaccines(s) Vaccinia virus DNA vaccine 4pox
References