VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

p27

Gene Name p27
Sequence Strain (Species/Organism) Hepatitis delta virus
NCBI Protein GI 226737605
Other Database IDs CDD:279813
Taxonomy ID 261991
Gene Strand (Orientation) ?
Protein Name Large delta antigen
Protein pI 10.45
Protein Weight 26158.73
Protein Length 329
Protein Note L-HDAg; p27
Protein Sequence
>sp|P0C6M5.1|LHDAG_HDVU2 RecName: Full=Large delta antigen; Short=L-HDAg; AltName: Full=p27; Flags: Precursor
MSRSESKKNRGGREEILEQWVGARKKLEELERDLRKIKKKIKKLEEENPWLGNIKGILGKKDREGEGAPP
AKRARADQMEVDSGPRKRPFRGEFTDKERRDHRRRKALENKRKQLSSGGKSLSKEEEEELRKLTEEDERR
ERRVAGPRVGGVNPLEGGTRGAPGGGFVPSMQGVPESPFARTGEGLDVRGNQGFPWDILFPADPPFSPQS
CRPQ

Molecule Role Protective antigen
Related Vaccines(s) Hepatitis D DNA vaccine pcDNA3p27/Ad5F35p27
References